KEGG   Bacillus subtilis subsp. subtilis 168: BSU02200
Entry
BSU02200          CDS       T00010                                 

Gene name
ybfG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1906 PG_binding_1
Other DBs
NCBI-GeneID: 938433
NCBI-ProteinID: NP_388102
Pasteur: BG12736
BSORF: BG12736
UniProt: O31447 A0A6M3Z781
LinkDB
Position
complement(239644..241842)
AA seq 732 aa
MVDEMVLITQQWLNDTYSGKHGYNPVEESGKTGWDTIYGLTRALQIELGISEPADNFGPT
TQRLFKPLKRQAPDSKPSNMNFILQGALWCKGFNPGGFTGVFYEKTENAVKEFQKAAGLT
TQDGIVTTLIMKALLDMSAFKLVSGGDSRIRQIQQNLNRDYNDYIGLMPCDGLYGRDTNK
ALIYALQKEEGMSTSVANGFFGNGTTSLCPTLTPGDSRTGFVLIVQYALYCNGKSFDPGE
FDGKYGVGVVSAVKAFQEFMCLPQTGYADMPTIKALLSSSGDTTRTASACDTATIITAEK
AQTLRNNGYKTVGRYLTGNVRTSSGLTSKALTSKELAVILDAGLKVFPIYQDGGYESSYF
VKDQGTRDAYSAASAARRLGFPSGTTIYFAVDFDAYDYEVTDKIIPYFQEIKSAFTKMQT
FSTAPKYEIGVYGPRNICIRTSEAGLTKYSFVANMSTGFSGNLGYPMPNNWAFDQFYEGT
IGSGSGSIGIDKDGYSGRDSGASNVNPPSDPVYDARLRTLTDILSTIPALENLTSLANAM
FEFDTTETIFTSPELDIILSTSLLATIPSEGSPNTITITNGKPGAYITGLLGDTQTSLTA
SQIDSYQNLLNSLSLSVRNGYLEVYVNPTAESLNIQIKIYTPDIPVGDNVTTGLTTTITF
KIKTYKGVPVTSPESELALDWPSYDQYLFPVVGVAALLLIGNMGSDLTNNKGVKVATALS
AMLLAIFAYYTS
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggttgatgaaatggtcttaatcacacagcaatggctgaacgatacgtacagcggcaaa
catgggtataacccagttgaagaaagcgggaaaactgggtgggatacgatctacggtctg
actcgggcgcttcaaattgaattgggtatctcagagccagccgataacttcgggccgaca
acacagcgcttatttaagcctcttaaacgccaagctccagattcaaaaccaagcaacatg
aattttattttacaaggggctttatggtgtaaaggctttaatcccggcggttttacaggc
gtcttttacgaaaaaacagaaaatgcggtaaaagaatttcaaaaagctgccggactgaca
acacaggatgggattgtcaccacgttaattatgaaagccttattagacatgagcgctttt
aagctggtgtctgggggtgattcaagaattcgccagattcaacaaaacttaaatcgagac
tacaatgactatatcgggttaatgccttgtgacggactgtatggccgcgatacaaataaa
gctcttatttatgccctgcaaaaagaagaaggcatgagcacaagtgttgccaatggattt
ttcggaaacggcaccacaagtttgtgccctactttaactcccggcgattcaagaacagga
tttgtcttaattgttcagtacgccctctattgtaacggaaaatcgttcgatcctggtgag
tttgacggcaaatatggtgtgggtgttgtttcagctgttaaagcatttcaagagttcatg
tgcctgccgcaaacaggttatgcagatatgccaaccattaaagctttattatcaagctca
ggagacacaactcgcaccgcttctgcttgtgacactgctacaattataaccgcagaaaaa
gctcaaacactgcggaataacggttataaaacggttggcagatatttgaccggaaatgtg
cggacaagcagcggcctcacatctaaagccctgacatctaaagagcttgcagttattctt
gatgccggattgaaggttttcccaatttatcaagacggcggctatgaatcttcttatttt
gtcaaagaccaaggcacaagagatgcatatagtgccgcttctgctgctagaagattaggt
tttccgtcaggcacgaccatttatttcgctgtcgattttgatgcatacgattatgaagtg
accgataaaatcattccttatttccaagagattaagtcagcatttacaaaaatgcagaca
ttttcaaccgcacctaagtatgaaataggggtttacggaccaagaaacatttgtatccgt
acatctgaagcaggactgacaaagtatagttttgtggcaaatatgtcaacaggatttagc
ggcaatctcggctatccgatgccaaacaactgggcctttgatcaattttatgaaggaacc
atcggaagcggctctggaagcatcgggattgataaagacgggtattcaggaagagactca
ggtgcaagcaatgtaaatccgccgtctgatccggtatatgatgcaagactgcgtacactg
acagacattttatctaccattccagctttagaaaatctaacaagtctggcaaacgcgatg
tttgaatttgatacgacagaaaccattttcacatcacctgagttggatattattctatca
acttcacttctggcaaccataccaagtgaaggttcaccaaacacaattaccattacaaat
ggtaaaccaggtgcctatatcacgggtttattgggcgacactcaaacgtctctcactgcg
tcacaaatcgactcttatcaaaaccttttaaatagtctgagcttatcagtacgcaacggt
tatttggaggtttatgtaaatccaacagctgaatctttaaacattcaaattaaaatctat
acacctgatattccagtcggtgacaatgtcacaactggactaacgactacgattacgttt
aaaataaagacgtacaagggagtaccagttacgtctcccgagagtgaattagcgttagat
tggccgtcttatgatcaatatttattccctgttgtaggtgttgctgcacttttactaatt
gggaatatgggcagtgatttaacgaacaataaaggagtcaaagtcgctaccgcattatct
gctatgttactggccatttttgcttattatactagctaa

DBGET integrated database retrieval system