KEGG   Bacillus subtilis subsp. subtilis 168: BSU02370
Entry
BSU02370          CDS       T00010                                 
Symbol
ybgA
Name
(RefSeq) GntR family transcriptional regulator
  KO
K24966  GntR family transcriptional regulator, amino sugar utilization regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU02370 (ybgA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU02370 (ybgA)
SSDB
Motif
Pfam: UTRA GntR HTH_DeoR HTH_41 TrmB HTH_11 HTH_36 Ribosomal_S19e DprA_WH HTH_24 HTH_28
Other DBs
NCBI-GeneID: 938422
NCBI-ProteinID: NP_388119
Pasteur: BG12747
BSORF: BG12747
UniProt: O31459 A0A6M4JCD6
LinkDB
Position
257791..258498
AA seq 235 aa
MTALYSVIKFKIIELIKSGKYQANDQLPTESEFCEQYDVSRTTVRLALQQLELEGYIKRI
QGKGTFVSAAKIQTPIPHKITSFAEQMRGLRSESKVLELVVIPADHSIAELLKMKENEPV
NKLVRVRYAEGEPLQYHTSYIPWKAAPGLAQEECTGSLFELLRTKYNIEISRGTESIEPI
LTDETISGHLLTNVGAPAFLSESLTYDKNEEVVEYAQIITRGDRTKFTVEQSYHS
NT seq 708 nt   +upstreamnt  +downstreamnt
atgacagctttatattctgttatcaagtttaaaatcattgagttaattaaatcgggcaaa
tatcaggcgaatgatcagctgccgacggagagtgagttttgcgaacaatatgatgtcagc
agaacaactgtgagactggctctgcagcagctagagcttgagggatatattaaaagaatt
caaggaaaagggacatttgtatcggcggccaaaatacaaacgccgattccgcataagatt
acgagctttgcagaacaaatgagaggacttcgttctgaatcaaaagtgcttgagcttgtg
gtgattcctgccgatcattccatcgccgagcttttgaaaatgaaagagaatgaacctgtc
aacaagcttgtcagagtcagatacgccgagggggaacctttgcagtatcatacctcatat
attccctggaaggcggcaccggggctggcgcaggaggaatgcaccggctcgctgtttgaa
ttgttaaggacaaaatacaatattgaaatcagcaggggcacggaatcgatcgaaccgatt
ttaacggatgaaacgatcagcggacacttattaaccaatgtcggagcgcctgcgttttta
tcagaatcccttacctatgataaaaatgaagaagtggtggaatatgcgcaaattattaca
cggggagaccgaacgaaattcaccgtagaacagtcatatcattcataa

DBGET integrated database retrieval system