KEGG   Bacillus subtilis subsp. subtilis 168: BSU02470
Entry
BSU02470          CDS       T00010                                 

Symbol
ycbD
Name
(RefSeq) aldehyde dehydrogenase YcbD
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU02470 (ycbD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BSU02470 (ycbD)
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 938406
NCBI-ProteinID: NP_388129
Pasteur: BG11159
BSORF: BG11159
UniProt: P42236 A0A6M4JCE8
LinkDB
Position
268846..270312
AA seq 488 aa
MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNSTAEDVERAVTAANEA
KTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPEAKGETARGIAILRYYA
GEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVVIK
PATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHDGVNAVTFTGSNQVGKI
IGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGAFRSTGQKCTATSRVIVQSG
IYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNCLSYIEKGKQEGASLLIGGEK
LENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALIKVDSIEEALNIANDVKFGLSA
SIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGEAAKDFFTA
IKTVFVKP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtctgtgatcacggaacaaaacacgtacctcaactttattaacggagagtgggttaag
tctcaatcaggcgatatggtcaaagtcgaaaaccctgccgatgtgaatgatattgtcgga
tatgtacagaattcaacggctgaagatgtggaacgtgccgtcaccgccgccaatgaagcc
aaaacggcttggagaaagctgacgggtgccgagcgcggccaatacttatacaaaacagcg
gatatcatggagcagcgcttggaggaaatcgccgcctgtgcaacgcgtgaaatgggtaaa
acattgccggaagcgaagggagaaacagcccgggggattgccattctgcgctattacgcc
ggagagggcatgcgaaaaacgggtgacgtcattccgtctactgacaaagacgcgctcatg
tttaccacccgtgttccgctcggtgtggtcggtgtgatttctccgtggaacttcccagtg
gcgattccgatttggaaaatggcgccggcattggtatacggcaataccgttgtcatcaaa
ccggcgacagaaacagctgtgacatgcgcgaagatcattgcctgctttgaggaagcgggg
ctcccggcaggggtcatcaatttggtgacaggcccgggttctgttgtcgggcaggggctt
gctgagcatgacggtgtaaacgccgttacgtttaccggttcaaatcaagtcggaaaaatc
atcgggcaagccgctttagcgaggggagccaaatatcagcttgagatgggcggcaaaaac
cctgtcatcgtagctgatgacgctgaccttgaagctgcggcagaagctgtcataacgggg
gccttccgttcaaccggccagaaatgcaccgcgacaagccgtgtcatcgtacaaagcgga
atttacgagcgctttaaagaaaaactgctccagcgcacaaaagatattacaatcggagac
agcttaaaagaggatgtctggatgggaccgatagccagcaagaatcagcttgataactgc
ctgtcatacattgagaaaggcaaacaggagggcgcttcccttttaataggaggagaaaag
ctggagaacggaaagtatcaaaacggctattatgttcagcctgccatctttgacaatgtg
acatctgagatgacaattgcccaggaggaaattttcggtccggtgatcgccttgatcaag
gtggactcgatagaggaggcgctgaacatcgccaatgatgtgaagttcggtttaagtgca
tccatcttcacggaaaacatcggccgaatgctttctttcattgatgaaatcgatgccggg
ctggttcggatcaatgcagaaagcgcaggtgttgagctgcaggcgccttttggcggcatg
aagcagtcgagctcccactcccgagaacagggtgaggcagcgaaggactttttcacagcg
atcaaaactgtttttgtgaagccgtaa

DBGET integrated database retrieval system