KEGG   Bacillus subtilis subsp. subtilis 168: BSU02560
Entry
BSU02560          CDS       T00010                                 

Gene name
ycbM
Definition
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_2 HATPase_c_5 Enkurin Rad50_zn_hook HATPase_c_3 DUF1542
Other DBs
NCBI-GeneID: 938397
NCBI-ProteinID: NP_388138
Pasteur: BG11168
BSORF: BG11168
UniProt: P42245 A0A6M4JJP7
LinkDB
Position
279059..279994
AA seq 311 aa
MTVLWVAAVIALACLNVIQFIMKKKRDGNLAYTADQLSYMLSRDSAGQILLPTDDHALKD
LLVNINLIVENRQQISAQFAKTEQSMKRMLTNMSHDLKTPLTVILGYIEAIQSDPNMPDE
ERERLLGKLRQKTNELIQMINSFFDLAKLESEDKEIPITKVHMNDICKRNILHYYDAVQS
KGFQAAIDIPDTPVYAQANEEALDRILQNLLSNAIQYGAAGKLIGLTLSYDERNIAITVW
DRGKGISETDQQRVFERLYTLEESRNKAFQGSGLGLTITKRLTEKMGGIISVQSKPYERT
AFTITLKRMTY
NT seq 936 nt   +upstreamnt  +downstreamnt
atgacagtgctatgggtggccgctgtcatcgctctggcgtgtctgaatgtgattcaattc
ataatgaaaaagaagcgggacgggaatctggcttacacggctgaccagcttagctacatg
ctcagccgggattcggcaggacaaattttgcttcctacagacgatcatgcgctcaaagac
ttgcttgttaacatcaatcttatcgttgagaatcgtcagcagatcagcgcccaatttgcc
aaaacagagcaatccatgaagcggatgctgaccaatatgtcgcacgacctgaaaacgccg
ttaacggtcattctcggttatattgaagccattcaaagtgacccgaacatgccggacgaa
gagcgggaaagattgctggggaagctccgccagaaaacaaatgaacttattcagatgatc
aattccttttttgatttagcgaaattagaatctgaagataaagagatcccgatcaccaaa
gtacatatgaacgacatatgcaaacgaaatatcctgcactattatgacgctgttcagtca
aaaggctttcaagcagccatcgatatccccgatacgccggtgtatgcgcaggcgaatgaa
gaggctctggacagaatcctgcaaaacctattgtccaatgcgattcaatatggcgcggcc
ggcaagttaatcgggctgacgctgtcttatgatgagaggaacatcgccatcaccgtatgg
gatcgcggaaaagggattagtgaaaccgatcagcagcgggtgtttgagaggctgtacaca
ctggaagaatccagaaataaagcatttcaaggaagcggcttgggtttaaccatcacaaaa
cggcttacagaaaaaatgggaggcatcatatccgtccaaagcaagccgtacgaacggact
gcatttacgatcacattgaaacgcatgacatattaa

DBGET integrated database retrieval system