KEGG   Bacillus subtilis subsp. subtilis 168: BSU02750
Entry
BSU02750          CDS       T00010                                 
Symbol
natA
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K09697  sodium transport system ATP-binding protein [EC:7.2.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU02750 (natA)
  09132 Signal transduction
   02020 Two-component system
    BSU02750 (natA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02750 (natA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.4  ABC-type Na+ transporter
     BSU02750 (natA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Sodium transporter
    BSU02750 (natA)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_22 NTPase_1 AAA_23 AAA NACHT AAA_29 AAA_15 TsaE ABC_ATPase AAA_16 AAA_30 DO-GTPase2 AAA_13 Zeta_toxin ATP-synt_ab UPF0259 KAP_NTPase PIF1 AAA_27 SRP54 Sigma54_activat
Other DBs
NCBI-GeneID: 938386
NCBI-ProteinID: NP_388157
Pasteur: BG11338
BSORF: BG11338
UniProt: P46903 A0A6M4JI76
LinkDB
Position
296429..297169
AA seq 246 aa
MITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQG
VITVDGFDTVKQPAEVKQRIGVLFGGETGLYDRMTAKENLQYFGRLYGLNRHEIKARIED
LSKRFGMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFI
QQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALESLYESERSEDLNYIFMSK
LVRGIS
NT seq 741 nt   +upstreamnt  +downstreamnt
atgattacactgaccgattgcagccgcaggtttcaggataagaaaaaagtagtcaaagcg
gtgcgagatgtaagcttaacaattgaaaaaggagaagtcgtcggcattctcggagaaaac
ggtgccggcaaaacgacgatgctgagaatgattgcttccttgcttgaaccatcacagggt
gtaatcacagtagacggctttgacacggtcaagcagccggctgaggtcaaacaaagaatc
ggtgtcttattcggaggagaaaccgggctttacgacaggatgaccgctaaagaaaatctc
caatacttcggcaggctgtatgggctgaaccgccacgagatcaaagcaagaatagaagat
ttatcgaaacggttcggcatgcgcgattatatgaaccggagagtgggcgggttttcgaaa
ggcatgaggcagaaagtcgccattgccagagcgctgattcacgatccggacatcatttta
tttgatgagccgacaactgggcttgatattacgtcaagcaacatcttccgcgaatttata
cagcagctgaaaagagaacaaaaaacgattcttttctccagccacattatggaggaagtg
caggcgctctgtgacagtgtcatcatgattcacagcggagaggtgatttaccgaggggcg
cttgaatcactatacgagagcgagcgcagtgaggatttgaattacatctttatgtctaag
cttgtcagggggatttcttaa

DBGET integrated database retrieval system