KEGG   Bacillus subtilis subsp. subtilis 168: BSU04460
Entry
BSU04460          CDS       T00010                                 
Symbol
dctR
Name
(RefSeq) C4-dicarboxylate response regulator DctR
  KO
K11692  two-component system, CitB family, response regulator DctR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU04460 (dctR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU04460 (dctR)
Two-component system [BR:bsu02022]
 CitB family
  DctS-DctR (C4-dicarboxylate transport)
   BSU04460 (dctR)
SSDB
Motif
Pfam: Response_reg HTH_11 HTH_DeoR FaeA HTH_3 HTH_IclR Crp MarR_2 HTH_24 HTH_17 HTH_Crp_2 HTH_37 TrmB HTH_29 HTH_23 HTH_36 Rrf2 HTH_20 VpsR EcoRII-N DUF2570
Other DBs
NCBI-GeneID: 940148
NCBI-ProteinID: NP_388327
Pasteur: BG12074
UniProt: P96602 A0A6M4JDH5
LinkDB
Position
499365..500045
AA seq 226 aa
MARKEWKVLLIEDDPMVQEVNKDFITTVKGVTVCATAGNGEEGMKLIKEEQPDLVILDVY
MPKKDGIKTLQEIRKQKLEVDVIVVSAAKDKETISLMLQNGAVDYILKPFKLERMRQALE
KYKQYKQKIEANDTLSQEQLDAILNIPQQAVQDLPKGLNHFTMNEVTAFLKQQTASLSAE
EVAKALGIARVTARRYLDYLEKTGIIKLDVQYGGVGRPVNRYVLKG
NT seq 681 nt   +upstreamnt  +downstreamnt
atggctcgtaaagaatggaaggttctgctcattgaagacgatccgatggttcaagaggtc
aataaggatttcattacaactgttaaaggcgttactgtctgtgcaacggcaggaaacgga
gaggaaggcatgaagctgattaaagaagaacagccagatctcgtcattctcgatgtgtac
atgccgaaaaaagacggcatcaagaccttgcaggagatcagaaagcaaaagcttgaagtg
gatgtcattgtcgtctccgctgcaaaagacaaggaaacgatctcactcatgctgcaaaac
ggggcggttgactatatcttaaagccgtttaagcttgagcgaatgagacaggcactcgaa
aagtacaagcaatataaacaaaaaatcgaagcgaatgatacgctgtcccaggaacagctc
gatgcgatcctgaatattccgcagcaggccgtacaggatctgccgaaagggttgaatcac
ttcacgatgaatgaagtcactgcttttttgaaacagcaaaccgcatccctttctgctgaa
gaggttgccaaggcgctcggcatcgccagagtgacagccagacgatatcttgattactta
gaaaaaaccgggatcatcaaattggacgttcaatacggcggagtcggccggccggtcaac
cgctacgtgttaaaaggataa

DBGET integrated database retrieval system