KEGG   Bacillus subtilis subsp. subtilis 168: BSU05460
Entry
BSU05460          CDS       T00010                                 

Gene name
ydfL
Definition
(RefSeq) GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GyrI-like MerR_1 MerR MerR-DNA-bind
Other DBs
NCBI-GeneID: 938078
NCBI-ProteinID: NP_388427
Pasteur: BG12159
BSORF: BG12159
UniProt: P96690 A0A6M3Z857
LinkDB
Position
complement(594186..594998)
AA seq 270 aa
MKEFFSIGEVSKLFNVKISALRYYDEIGLLKPEYKDEQTNYRYYSTQQFERLDTIKYLRA
LGLPINKLLDFYNSQNTNTLLHLLKSQQVEIDRKKKELERIERKISRRITHIEDAVNMPL
HQISKIKLPAMRVAYLQHEYVLGHDIEHSLAELRTHLNVNEDIFIGKIGLSISAANVKAK
QFDKYSSIFMILEDENEKTSSEIIFPSREYLQIRFKGSHPEAEPYYKKLLAYMKEHHYEV
AGDSIEITLIDYGITNNLDNYVTEILLPIK
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaaggaatttttttcgattggagaagtgtcaaagttattcaatgtgaaaatctctgct
cttcggtattatgatgaaatcggccttttgaaaccggaatataaagatgagcaaacgaac
tatagatattattctacccaacagtttgagcggctggataccatcaagtatttgagggcc
ctaggcctgccaatcaataagcttcttgatttttataactctcaaaatacaaacactctt
cttcatttactaaaaagccagcaggttgaaattgatcgcaagaagaaagaattggaacgc
attgaacgaaagatctcccgacgcatcacacatatagaagatgccgttaacatgccgtta
catcaaatttcaaaaatcaaacttcccgcaatgcgtgtggcctatttgcagcatgaatat
gttctcggccatgatatcgaacattcgttagctgaattgagaacccacctgaatgtaaac
gaagatatattcataggcaagattggtttatccatttctgcagcaaatgtgaaagcaaaa
cagtttgacaaatattccagtatatttatgattcttgaagatgaaaatgaaaaaacttct
tcagaaatcatctttccttcaagagaatatctgcaaattaggtttaaagggtcacatcca
gaagccgaaccatactacaaaaaattactggcatatatgaaagaacatcattatgaggta
gcaggggactcaatcgaaatcacactcattgattatggcattacgaataacctagataat
tacgtgactgaaatcctgctgcccatcaaataa

DBGET integrated database retrieval system