KEGG   Bacillus subtilis subsp. subtilis 168: BSU05840
Entry
BSU05840          CDS       T00010                                 
Symbol
gmuD
Name
(RefSeq) 6-phospho-beta-glucosidase GmuD
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU05840 (gmuD)
   00500 Starch and sucrose metabolism
    BSU05840 (gmuD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BSU05840 (gmuD)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-GeneID: 939872
NCBI-ProteinID: NP_388465
Pasteur: BG12193
BSORF: BG12193
UniProt: O05508 A0A6M3Z8A5
LinkDB
Position
628630..630027
AA seq 465 aa
MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQ
FYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAADFYNNVIDELIANGIEPF
VNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYL
YDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADV
KAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNY
YQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYG
NIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTF
MDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF
NT seq 1398 nt   +upstreamnt  +downstreamnt
ttggcacatacagaacaatatcgttttccaaaggatttttggtggggatcatccgcttca
gcaacacaaatggagggtgccgccgacagagacggaaaaggccagaatatatgggattat
tggtttgaaaaagaaccgcatcgtttttttgatcatgtcggacccgcagacacatcccaa
ttttacgacaactataaagaagatatcaggctgatgaaggaacttggccacaactcgttc
cggatgtcgatttcctggtcacgtttaataccaaacggaacgggcgagatcaacgataaa
gccgcagatttctataacaatgtcattgatgagctgatcgctaacggaattgaacctttt
gtcaatttgtttcatttcgatatgccgatggcgcttcaaaaaatcggcggctgggtcaac
agagagacggttgacgcgtatgaaaactatgcaagaacttgcttccgtttgtttggcggc
cgggtgaaaaaatggttcacgcataatgaaccaatcgttcccgtagaaggcggataccta
tatgattttcattatccaaacaaggtcgattttaaagaggccgtccaggttggatttcat
acgatgctatcaagtgcccgcgccattcaggcttacagggagatgaagcaggacggaaaa
atcggcatcatcttaaatttgaccccttcatacccgagaagcagccatccggcggatgtg
aaagccggggaaatcgcagacgcgttttttaacagatcttttttagacccatctgtcaaa
ggcgaatttcccaaagagctggttgacattttgaagcatgaaggctttatgcctgattac
aacgctgaagatctcgacatcatcaaaaagaacacggttgacctgttgggagtgaattat
taccagccgagacgtgtgaaagcgaaagaacatcttccgaatcccgacgctccttttttg
ccggacaggtattttgatccctacgtcatgccgggccgcaaaatgaatccgcatcgcggc
tgggagatctatgaaaaaggcgtttatgatattttgatcaatttaaaagaaaactacggc
aacatcgagtgttttatctctgaaaacggtatgggggttgaaggtgaagagcgattcagg
gatgaacaaggcatcattcaggatgattaccggattgaatttataaaagagcacctcaaa
tggattcaccgcgccatacaggaaggctcgaacgtaaaaggctatcacttatggacgttc
atggacaactggtcttggacaaatgcctataaaaaccgatacggatttgtatcagtcaat
cttgagaaagacggagaaagaaccgtcaaaaagagcggaaaatggttcaaagaggttgct
gagcatagcggtttctag

DBGET integrated database retrieval system