KEGG   Bacillus subtilis subsp. subtilis 168: BSU06150
Entry
BSU06150          CDS       T00010                                 
Symbol
gutB
Name
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU06150 (gutB)
   00051 Fructose and mannose metabolism
    BSU06150 (gutB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BSU06150 (gutB)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox Methyltransf_25
Other DBs
NCBI-GeneID: 939495
NCBI-ProteinID: NP_388496
Pasteur: BG10177
BSORF: BG10177
UniProt: Q06004 A0A6M3ZB92
LinkDB
Position
667466..668527
AA seq 353 aa
MTHTVPQNMKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNY
VVEKPFILGHECAGEIAAVGSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFL
ATPPVDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMG
MGPVGLMAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDR
GVDVAWETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYGIFRYA
NTYPKGIEFLASGIVDTKHLVTDQYSLEQTQDAMERALQFKNECLKVMVYPNR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgactcacacagtacctcaaaacatgaaagcggctgttatgcacaacacaagagagatc
aaaattgaaacattgcctgtgcctgatatcaatcatgatgaagtgttgattaaggtgatg
gctgtcggaatttgcggatctgatctgcattactatacaaatggccgaataggcaactat
gttgtggaaaaaccatttatccttgggcatgaatgtgcgggtgaaattgccgctgtcgga
tcatctgtcgatcaattcaaggtgggagaccgcgtcgctgtagagccgggtgttacgtgc
ggacgctgtgaggcgtgcaaagaaggacgctataatctttgcccggatgtacagtttttg
gctacaccgccggtagacggtgcgtttgtccaatatattaaaatgcgtcaggactttgtt
tttttaatcccagactcactttcttatgaagaagctgctttgatcgagccgttttctgtc
ggtatccatgcggcggccagaacgaagctacagcccggatcaacgattgcgattatgggg
atgggccctgttgggttaatggctgttgccgcagctaaagcatttggggcaggcacaatc
attgtcaccgacttagagccgctgcggttagaagctgcgaaaaaaatgggagcgactcac
attattaatatacgtgaacaggatgcacttgaagagattaaaacgatcacgaatgataga
ggcgttgatgttgcttgggaaacagcagggaatccagcggcattgcaatccgcactggct
tctgtgcgccggggcggaaaattggcgattgtcggtttgccttcacagaacgagattccg
ctcaacgtgccgtttattgcggataatgagattgatatttacgggatcttccgttatgcc
aatacgtatccaaagggaatcgaatttcttgcttcaggcattgtggacacgaagcatcta
gtaacggaccaatattcgctggagcagacgcaagatgcgatggagcgggcgcttcaattt
aagaatgaatgtttaaaagtgatggtgtatccaaatcgctga

DBGET integrated database retrieval system