KEGG   Bacillus subtilis subsp. subtilis 168: BSU07430
Entry
BSU07430          CDS       T00010                                 

Symbol
yfmL
Name
(RefSeq) ATP-dependent RNA helicase YfmL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1 AAA_30 SecA_DEAD
Other DBs
NCBI-GeneID: 938792
NCBI-ProteinID: NP_388624
Pasteur: BG12963
BSORF: BG12963
UniProt: O34750 A0A6M4JE76
LinkDB
Position
816113..817243
AA seq 376 aa
MTQTWPFLHNAQSFIQENWNASGFQKPTPVQEQAAQLIMDGKDVIAESPTGTGKTLAYAL
PVLERIKPEQKHPQAVILAPSRELVMQIFQVIQDWKAGSELRAASLIGGANVKKQVEKLK
KHPHIIVGTPGRVFELIKAKKLKMHEVKTIVLDETDQLVLPEHRETMKQIIKTTLRDRQL
LCFSATLKKETEDVLRELAQEPEVLKVQRSKAEAGKVKHQYLICDQRDKVKLLQKLSRLE
GMQALVFVRDIGNLSVYAEKLAYHHVELGVLHSEAKKMERAKIIATFEDGEFPLLLATDI
AARGLDIENLPYVIHADIPDEDGYVHRSGRTGRAGKEGNVLSLVTKLEESKLKKMAKKLG
VELSEAVYAGGKLKTK
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgacgcaaacttggccatttttacataatgcacaatcatttatacaagagaattggaat
gcttccggctttcaaaagccaacccctgttcaggagcaggcagcccagctgatcatggac
ggaaaggatgtcattgcagaatcgccgacaggcacagggaagacgctggcgtatgcgctg
ccggtcttggagcggatcaaaccagagcaaaagcatccgcaggcggtgattttagcgcct
tcccgtgagctggtcatgcagatttttcaggtgattcaggattggaaagcgggctcagag
ctgcgcgcggcttccttaatcggcggggcgaatgtgaagaaacaggtcgaaaagctgaag
aaacatccgcatatcatcgtcggcacgccaggcagggtgtttgaactgattaaagcgaag
aaactcaaaatgcatgaagtgaaaacgatcgtgcttgatgaaacggatcagctcgtcctg
ccggagcatcgcgaaacgatgaagcaaatcattaaaacaacattaagagaccgccagctt
ctatgtttttctgccacgctcaaaaaggaaacagaggacgtgctccgcgaattggcgcaa
gagcctgaggtgttgaaggtgcagcgaagcaaggcggaggcagggaaagtgaagcatcaa
tacctgatttgcgaccagcgcgacaaagtgaagctgctgcaaaagctgtcaaggcttgaa
ggcatgcaggcactcgtatttgtgagagacattggcaacctgagtgtatatgcggaaaaa
ctggcatatcaccacgttgaactcggcgttttgcacagtgaagcgaaaaaaatggagcga
gcgaaaatcattgccacattcgaagacggagagtttcctcttttattggcgactgacatt
gccgcacgcggtttagatattgaaaacctgccatacgtgattcatgctgatattccagat
gaagatggctatgtccacagatcaggacgaacaggccgggccggaaaagaaggcaacgtg
ctgagccttgtgacaaaattggaggaatctaagctgaaaaaaatggcgaagaagcttggt
gttgagctgagtgaagctgtgtatgcaggcggaaaactgaagacgaaataa

DBGET integrated database retrieval system