KEGG   Bacillus subtilis subsp. subtilis 168: BSU09050Help
Entry
BSU09050          CDS       T00010                                 

Gene name
yhcE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding_3
Motif
Other DBs
NCBI-GeneID: 939256
NCBI-ProteinID: NP_388786
Pasteur: BG11583
BSORF: BG11583
UniProt: P54589
LinkDB All DBs
Position
980473..981234
Genome map
AA seq 253 aa AA seqDB search
MNSFLGLLKKDIKLSRMWLLVWICGIIFLLGTGHIIASRTKEPLVIFGFFVAVAFFLLFL
SPVFVFYHLRKEGKSQLWLYNPNGGLWLFSSKLAASLLYQFVIQLALTAYGIWMYHMLSV
KNLLEHQVDITSTVALLNMYGLISSLDMSVTVIVFWTVFHSLRNWRGMRWAAMVLLVAMW
LFFDEYIISPLVESQKHFWPVTVYCNFDFHFHNVWRLELKPIHLSVLGFPIAIVITFLLL
IMASKLLDRKVEV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttttttaggtttattaaagaaagatatcaagctttcaagaatgtggctgcta
gtatggatatgcggaatcattttcttattgggaacaggccatattatagcttctcgcacg
aaagaacctctagtcatttttggtttttttgttgcagttgctttttttctgcttttctta
tctcctgtttttgttttttatcaccttcgcaaggaagggaaatcacagctttggctgtac
aatccaaatggcggcttatggctgttttcttctaaattggcagcatctttgctctatcaa
tttgtgattcagttggcattaacagcctatggcatatggatgtatcatatgctctctgta
aaaaatctgctggagcatcaagttgatataacgagtacagtggctttgctgaatatgtat
gggcttatttcttcgttagatatgtcagtaacagtcattgtgttttggactgtttttcac
tctctcagaaattggcgcggaatgcggtgggctgcgatggttctgttggtcgcaatgtgg
ttattcttcgatgaatacatcataagccctttggttgaatctcaaaagcatttctggcct
gtaacagtctattgcaattttgatttccacttccacaatgtttggagattggaactaaaa
cctatccatctgtctgtgctagggtttcctattgctatagtcatcacattcttgctgctc
atcatggcttcaaaactgcttgatcgtaaagtagaggtgtaa

DBGET integrated database retrieval system