KEGG   Bacillus subtilis subsp. subtilis 168: BSU09230
Entry
BSU09230          CDS       T00010                                 
Symbol
yhcV
Name
(RefSeq) CBS domain-containing protein YhcV
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CBS PmbA_TldD_C
Other DBs
NCBI-GeneID: 939740
NCBI-ProteinID: NP_388804
Pasteur: BG11600
BSORF: BG11600
UniProt: P54606 A0A6M4JEN3
LinkDB
Position
997175..997597
AA seq 140 aa
MSSVKDTMTTQVATVSPNQTIQEAASLMKQHNVGAIPVVEQGVLKGMLTDRDIALRTTAQ
GRDGQTPVSEVMSTELVSGNPNMSLEDASQLMAQHQIRRLPIVDQNNLVGIVALGDLAVN
QMSNESAGSALTNISHQNIH
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagttcagttaaagatacaatgacaacgcaggtggcaaccgtttctccgaatcaaacg
attcaggaagcggcttctctaatgaaacagcataacgtcggggcgatccccgttgtagag
caaggtgttttaaaaggaatgctgactgaccgtgacattgcattaagaactacagctcag
ggccgtgatggccagacacccgtttcagaagtgatgtcaacagaactcgtatcaggaaac
cctaatatgagtctggaagacgcgtcgcagctgatggcccagcaccaaatccgccgcctt
cctattgtagatcaaaacaatctagtcgggatcgttgcgcttggagacctggcagtcaat
cagatgtcgaacgagtctgcgggatcagcgctgacaaacatttctcaccaaaacattcat
taa

DBGET integrated database retrieval system