KEGG   Bacillus subtilis subsp. subtilis 168: BSU10960
Entry
BSU10960          CDS       T00010                                 

Gene name
yitE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YitT_membrane
Other DBs
NCBI-GeneID: 936377
NCBI-ProteinID: NP_388977
Pasteur: BG13110
BSORF: BG13110
UniProt: O06740 A0A6M3Z9A8
LinkDB
Position
complement(1174136..1174765)
AA seq 209 aa
MAELLMKAKLTFMIVVGGVLQGLGMSLFLFPHDIPTGGAAGIAVLLHYLFQIPHGFSVWA
VNVSMLFTALKWLEMRTFTGTLASITVTSVSVLIFDAVFPDITSNLWLDLASGAVLLGLG
IGLLYKYKISNGGFGALALMISIYRGGNPGTILLIMNCIIFMVTASIIDWGIVIQALICQ
VISTRVIDFIYNIRLTSLPYLTPMYRHKK
NT seq 630 nt   +upstreamnt  +downstreamnt
atggctgaactgctgatgaaagcaaaacttacgtttatgattgtcgtaggcggcgtacta
caaggactcggcatgtccttgtttttatttccgcatgatattccgacaggcggtgcagca
ggtattgcggtgctattgcattatctgtttcaaatcccccacggattttcagtgtgggct
gtgaatgtatcaatgctttttaccgctttaaaatggctggagatgagaacattcaccggc
accctcgcttctatcaccgtcacctctgtctcggtattgatctttgatgcagtttttcct
gatatcacatctaacctgtggcttgatctggcaagcggcgcagtgttattgggactcgga
atcggacttttatacaaatataaaatttcgaacggaggattcggagcccttgctctgatg
atttctatctaccgcggcgggaatcctggaacgatcctgctcatcatgaattgcatcatt
tttatggtcaccgcgtctattattgactggggcatcgtcattcaagccctcatatgccag
gtgatatcgacaagagtcatcgacttcatctacaacatccgcctgacctcacttccctat
ctcacgcctatgtaccgccataaaaaataa

DBGET integrated database retrieval system