KEGG   Bacillus subtilis subsp. subtilis 168: BSU12900
Entry
BSU12900          CDS       T00010                                 

Gene name
htrA
Definition
(RefSeq) serine protease Do-like HtrA
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01503  Cationic antimicrobial peptide (CAMP) resistance
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU12900 (htrA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSU12900 (htrA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU12900 (htrA)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU12900 (htrA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     BSU12900 (htrA)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   BSU12900 (htrA)
Chaperones and folding catalysts [BR:bsu03110]
 Other chaperones and cochaperones
  DegP / HtrA
   BSU12900 (htrA)
SSDB
Motif
Pfam: Trypsin_2 PDZ_2 Trypsin PDZ_6 PDZ GRASP55_65 Peptidase_S46 Apt1 DUF3394 Prp31_C
Other DBs
NCBI-GeneID: 939849
NCBI-ProteinID: NP_389173
Pasteur: BG12608
BSORF: BG12608
UniProt: O34358 A0A6M4JJ38
LinkDB
Position
complement(1357936..1359285)
AA seq 449 aa
MDNYRDENRTKGNENEVFLTKENDQSASYSARNVIHDQEKKKRGFGWFRPLLGGVIGGSL
ALGIYTFTPLGDHDSQDTAKQSSSQQQTQSVTATSTSSESKKSSSSSSAFKSEDSSKISD
MVEDLSPAIVGITNLQAQSNSSLFGSSSSDSSEDTESGSGSGVIFKKENGKAYIITNNHV
VEGASSLKVSLYDGTEVTAKLVGSDSLTDLAVLQISDDHVTKVANFGDSSDLRTGETVIA
IGDPLGKDLSRTVTQGIVSGVDRTVSMSTSAGETSINVIQTDAAINPGNSGGPLLNTDGK
IVGINSMKISEDDVEGIGFAIPSNDVKPIAEELLSKGQIERPYIGVSMLDLEQVPQNYQE
GTLGLFGSQLNKGVYIREVASGSPAEKAGLKAEDIIIGLKGKEIDTGSELRNILYKDAKI
GDTVEVKILRNGKEMTKKIKLDQKEEKTS
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggataactatcgtgatgaaaacagaacgaaaggtaatgagaatgaggtctttttaacg
aaagagaacgatcagagcgcctcctactcggcccgcaatgtcattcatgatcaggagaag
aaaaaacgaggattcggatggttcagaccgttgcttggcggagtgatcggcggcagtctt
gctcttggcatttacacgtttacaccgcttggtgaccatgattctcaggacactgcaaaa
caatcatccagccagcagcaaacgcaatctgttacagcaacaagcacctcctctgaatct
aaaaaaagctcaagcagctcatctgcattcaagagcgaggactcttctaaaatctcagat
atggtagaagacctttcaccagcgattgtcggtattacaaatcttcaggcacaatcaaac
agctctttgttcggctctagttcttctgattccagcgaagatacagaaagcggttcaggg
tcaggtgtcattttcaaaaaagagaatggcaaggcttatatcattacaaataaccacgtc
gtagaaggggcatcatcactgaaggtatctttatatgacggcactgaggttactgcaaag
ctggtaggcagtgactcgttaactgatttagccgtcctccaaatcagtgatgaccacgtc
acaaaagtggcaaacttcggtgattcatctgatcttagaacaggcgagaccgttattgcg
attggggatccgcttggaaaagacctgtcccgcacagtaacacaaggaattgtaagcggc
gtggacagaacggtttcaatgtctacatcagccggcgaaacgagcattaacgtcattcag
acagacgcagcaattaatccaggtaacagcggcggtcctttgttaaatacagacggcaaa
attgtcggcattaacagtatgaaaatcagtgaggatgatgttgagggtatcggattcgcc
attccaagcaatgacgtaaaaccgattgctgaagaattgctgtctaaaggacaaattgaa
cgtccatatatcggtgtcagcatgcttgatctagagcaagtgccgcaaaattaccaagaa
ggcacactcggcctgttcggcagccagctgaataaaggcgtttacatccgtgaggtcgct
tcaggctctcctgctgaaaaggccggattaaaagcggaggatattatcatcggcctaaaa
ggtaaagaaattgatacaggcagtgaattgcgcaatatcttatataaagacgcaaagatc
ggtgataccgttgaagtgaaaattctccgaaacggcaaagaaatgacgaaaaaaattaaa
ctggatcaaaaagaagagaaaacttcgtaa

DBGET integrated database retrieval system