KEGG   Bacillus subtilis subsp. subtilis 168: BSU13310
Entry
BSU13310          CDS       T00010                                 

Gene name
tnrA
Definition
(RefSeq) MerR family transcriptional regulator
  KO
K23776  MerR family transcriptional regulator, global nitrogen regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU13310 (tnrA)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    BSU13310 (tnrA)
SSDB
Motif
Pfam: MerR_1 MerR SBP_bac_8
Other DBs
NCBI-GeneID: 936445
NCBI-ProteinID: NP_389214
Pasteur: BG11805
BSORF: BG11805
UniProt: Q45666 A0A6M3ZDG7
LinkDB
Position
complement(1397411..1397743)
AA seq 110 aa
MTTEDHSYKDKKVISIGIVSELTGLSVRQIRYYEERKLIYPQRSSRGTRKYSFADVERLM
DIANKREDGVQTAEILKDMRKKEQMLKNDPQVRKKMLEGQLNAHFRYKNR
NT seq 333 nt   +upstreamnt  +downstreamnt
atgaccacagaagatcattcttataaagacaaaaaagtgatttcaatcggaattgtgagt
gaattgacaggattgtccgtaagacagatcaggtattatgaggaacgaaagctcatttac
ccgcagcgttcttcaagggggacaagaaaatactcctttgccgatgtggagcggctgatg
gatatcgccaataagcgtgaagacggcgtacagacggcagagattttaaaggatatgcgc
aaaaaagaacagatgttaaaaaacgatccgcaagtgcggaaaaaaatgctggaggggcag
cttaatgctcactttcggtacaaaaaccgttaa

DBGET integrated database retrieval system