KEGG   Bacillus subtilis subsp. subtilis 168: BSU14060
Entry
BSU14060          CDS       T00010                                 
Symbol
ykuF
Name
(RefSeq) 2,4-dienoyl-CoA reductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_2 Epimerase 3HCDH_N RmlD_sub_bind MbtH DFP ATP_bind_2
Other DBs
NCBI-GeneID: 939226
NCBI-ProteinID: NP_389289
Pasteur: BG13290
BSORF: BG13290
UniProt: O34717 A0A6M4JI36
LinkDB
Position
1478072..1478836
AA seq 254 aa
MEKKAVIITGGSSGMGKAMAKKQAELGWHVMVTGRNHEALEETKKEIQTFEGQVACFQMD
VRSDSAASDMIKEAVKAFGRLDALINNAAGNFICPAEKLTPNGWKAVIEIVLNGTFFCSQ
AAARHWIDQKQQGVILNMAATYAWGAGAGVVHSAAAKAGVLSLTRTLAVEWGSKYGIRTN
AIAPGPIERTGGAEKLFESEKAMARTMNSVPLGRLGTPEEIAALAAFLLSDEASYINGDC
ITMDGGQWLNPYPF
NT seq 765 nt   +upstreamnt  +downstreamnt
atggaaaaaaaggcggtaattattaccggcgggtcaagcggcatgggaaaagcgatggca
aaaaaacaggctgaattagggtggcacgttatggtgacagggaggaaccatgaggcactt
gaggaaacaaaaaaagaaattcagacctttgagggacaggtcgcttgttttcaaatggat
gtccgttccgattccgccgcttcagacatgattaaagaagcggtaaaagcctttggccgg
cttgacgcgctgattaacaacgcggccggaaactttatttgtccggcagaaaagctgacg
cccaatggatggaaagccgttattgagattgttttaaacggcacatttttttgcagccaa
gcagcggcaaggcattggattgaccagaagcagcagggtgtcattttaaatatggcagcc
acgtacgcttggggagcgggagcgggggtcgttcattccgctgcagccaaagcgggggta
ttgtcattgacaagaacgctggccgttgaatgggggagcaaatacggcattcgtacaaac
gcgatagcccccggaccgattgaacgaacaggcggtgcggagaagctatttgaatcggaa
aaagcgatggcccgcacgatgaacagtgtgccgctcggccgattgggcacaccggaggaa
atcgccgctttggcagcgtttttgctttctgatgaagcatcctatataaacggggattgt
atcacaatggacggggggcaatggctgaatccttatccgttttaa

DBGET integrated database retrieval system