KEGG   Bacillus subtilis subsp. subtilis 168: BSU14330
Entry
BSU14330          CDS       T00010                                 
Symbol
yknV
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU14330 (yknV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14330 (yknV)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU14330 (yknV)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_16 AAA RsgA_GTPase AAA_25 Zeta_toxin AAA_15 AAA_30 AAA_5 AAA_29 AAA_23
Other DBs
NCBI-GeneID: 936087
NCBI-ProteinID: NP_389316
Pasteur: BG13242
BSORF: BG13242
UniProt: O31708 A0A6M3ZAN6
LinkDB
Position
1501658..1503472
AA seq 604 aa
MKQAKKQGVLERFYYSSDEIIEKPFNWAQMWRLLSYVKPYRKTILPLSFLTVLIGTAVKL
VIPILIGVYVLDQAITGRNSELLIQLIFIISGLYVLNYAANVLRIRWMNQLGQHVIYDLR
QHLFTHVQRLSHRFFDQRSAGSILVRIMNDINSLQELFTSGVINLLTDLLLLAGVIIILF
TLSPELTIAIMVTLPIMFFISTSLRKKIRRSWQTVRLKQSKLNSHLNESIQGIRVTQAFT
QEEENMAYFDGVNQENYESWREATRKNAMFRPLVEMTNAIGTAVLIWYGATLIMNETITI
GVFVSFAFYLGMFWEPISRLGQVYNQLLMGMASSERIFEFLDEQPNVKEKPNAIHNEKIN
GEISFEEVEFSYDEKRKALHAVSFSIPAGSTLALVGHTGSGKTTIANLISRFYDAAGGTI
KIDGIPIKDLSLASLRSQISIVLQDTFIFSGTIMENIRFGRPNASDEEVMKASQAVGADE
FISDLAEGYATEVEERGSVLSAGQRQLISFARALLADPAIIILDEATASIDTETEVKIQQ
ALKTLLKGRTAVMIAHRLSTIRDADRIIVLDHGRKIEEGNHDQLLAKGGIYAGLVKAQYS
TAIE
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaaacaagcgaaaaaacagggggttttagagcgtttctattactcttcagatgaaatc
attgaaaagccgtttaactgggctcaaatgtggcggctgctgagctatgtcaaaccatat
cgaaaaacaattttgccgctttcttttctcactgtattgattggcactgctgtgaagctt
gtgatccccattttgatcggcgtttatgttcttgatcaagcgattacagggagaaactcg
gagctgctgattcagctcatttttattattagcggtttatatgtcctcaattacgccgcc
aatgtgttaagaatcaggtggatgaatcagcttggccagcatgtcatttacgatttgcga
cagcatttatttacccatgtgcagcgcttatcccatcgattttttgatcagcggtcggcg
ggatcgatcttagtcaggatcatgaatgatattaactctcttcaggagctctttacaagc
ggagtcatcaatttgttgaccgacttgctgcttctggccggcgtgattattattttgttt
acgctgagccctgagctgactatagccatcatggtgacattgccgattatgttttttatt
tcaacaagtctcagaaaaaaaatacgccgatcctggcaaacggtacggctgaagcaatcg
aagctcaactctcatctaaacgaaagcattcagggcatccgggtcacgcaggcatttacg
caggaagaagaaaacatggcgtattttgacggtgtcaatcaggagaactacgaatcatgg
cgggaagcaactagaaaaaatgccatgttccgtccgcttgtagaaatgacgaatgcgatt
gggacggctgtcttgatttggtatggagccacactcatcatgaatgaaaccattacgatt
ggcgtcttcgtttcttttgctttctatctgggaatgttttgggaacctatttcgagactg
ggtcaggtctataatcagctgttaatggggatggcatcatcagaacggatttttgagttt
ctggacgaacagccaaatgtcaaggagaagccgaatgccattcataatgaaaagataaat
ggggagatcagttttgaagaggttgaattttcgtatgatgaaaaacgaaaagcccttcac
gccgtttctttctctattcctgcgggatcgacgcttgcgcttgtcgggcatacagggagc
gggaagacgacgattgccaatttaatcagccgtttttatgatgcggccggaggcaccatt
aaaatagacggtataccgattaaggatctttcccttgccagtctgcgctctcaaatcagc
attgtcctgcaagatacatttattttctccgggaccatcatggaaaatattcgttttgga
aggccaaatgcttcggatgaagaggtgatgaaagcgtcccaagcggtcggagcggatgag
tttatttccgatttagcggaaggatacgcaacagaggtagaggaaaggggcagcgtactg
tctgccggtcagcgccagctcatttcatttgcaagagcattgctcgccgatccggctatt
atcatccttgacgaagcaacggcaagcattgatacagagacagaagtaaaaattcagcaa
gcgttaaaaacgcttctgaaagggcgtacagcagtgatgatcgctcacagattgtctacg
atccgcgacgccgaccgcatcattgttcttgatcacggcaggaaaatagaagaagggaac
catgatcagctgctcgctaaaggaggcatttatgccgggcttgtgaaagcgcaatacagc
acagcgatagaataa

DBGET integrated database retrieval system