KEGG   Bacillus subtilis subsp. subtilis 168: BSU18390
Entry
BSU18390          CDS       T00010                                 
Symbol
yoeC
Name
(RefSeq) integrase/recombinase YoeC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_integrase
Other DBs
NCBI-GeneID: 939595
NCBI-ProteinID: NP_389721
Pasteur: BG13550
UniProt: O35009 A0A6M4JKJ8
LinkDB
Position
complement(2003401..2003946)
AA seq 181 aa
MHIVQPIRSLEKIQEVKQYLLNKNKRDYFLFIFGINSALRISDILPLQVKDVQNKDHLWA
TESKTKKKRKILILESLKQEIYEYTKDMKENEYLFKSVRTRKPISRIQAYRILREAAAAC
GLEEIGTHTLRKTFGYHFYQRTKDIAELQRILNHSSPSITMRYIGIDEDTTRAAYKVFGG
L
NT seq 546 nt   +upstreamnt  +downstreamnt
atgcatattgtacagccgattcgcagtctagagaaaatccaagaagtcaaacagtatttg
cttaacaaaaacaagcgggattattttctgtttattttcggcatcaacagcgcgctccgt
atttctgatattctgccgctgcaagtgaaggacgttcaaaataaagatcatttatgggcg
actgaaagcaaaacgaaaaagaaaagaaagattcttattttagaatcgctgaaacaggaa
atatacgagtatacgaaagacatgaaggaaaacgaatatctttttaaatcagtgcggacc
aggaagccgatttcccgcattcaggcctacagaattttaagagaggccgctgcagcgtgc
ggacttgaggagatagggacgcatacactccggaaaacgtttggctatcatttttatcag
cgaacgaaagacatcgccgagctgcagagaatactgaatcattcatcaccatcaattaca
atgcggtatatcggtattgatgaagatacgacaagagccgcatataaggtttttggaggg
ctttaa

DBGET integrated database retrieval system