KEGG   Bacillus subtilis subsp. subtilis 168: BSU18870
Entry
BSU18870          CDS       T00010                                 

Gene name
yozI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cys_rich_CPCC
Other DBs
NCBI-GeneID: 939961
NCBI-ProteinID: NP_389768
Pasteur: BG13756
BSORF: BG13756
UniProt: O31838 A0A6M4JH27
LinkDB
Position
2057214..2057579
AA seq 121 aa
MPKLYTCLICGYKGLIQNPLNNDGEYQKTFDICPCCDFEYGYSEDHDVSLGFIVTPDYLI
DAAIQLYRKQWIENGMKTANPEDIPEELRNGDCLKFEVLLKQLNSLNLDTENFEIKGFNG
Y
NT seq 366 nt   +upstreamnt  +downstreamnt
atgccaaaattatatacatgtttaatttgcggatataaaggattaattcaaaacccatta
aacaatgatggtgagtatcaaaaaacatttgatatctgcccttgctgtgattttgaatac
ggctacagtgaagatcatgacgtaagcttaggttttattgtaactccagattatttaatt
gacgctgcaattcagttataccgaaaacagtggattgagaatggaatgaaaactgcaaat
cctgaagatattccagaagaattaagaaacggtgactgcttaaaattcgaggtgttgtta
aagcaattgaatagcctaaatctcgatactgaaaactttgaaatcaagggatttaatggt
tattaa

DBGET integrated database retrieval system