KEGG   Bacillus subtilis subsp. subtilis 168: BSU23280
Entry
BSU23280          CDS       T00010                                 

Gene name
ribD
Definition
(RefSeq) riboflavin biosynthesis protein RibD
  KO
K11752  diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
bsu02024  Quorum sensing
Module
bsu_M00125  Riboflavin biosynthesis, plants and bacteria, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU23280 (ribD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU23280 (ribD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     BSU23280 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     BSU23280 (ribD)
SSDB
Motif
Pfam: RibD_C dCMP_cyt_deam_1 MafB19-deam Inv-AAD Molybdopterin
Other DBs
NCBI-GeneID: 938945
NCBI-ProteinID: NP_390209
Pasteur: BG10518
BSORF: BG10518
UniProt: P17618 A0A6M3ZIR2
LinkDB
Structure
PDB: 
2B3Z 4G3M 3EX8 2D5N

Position
complement(2430258..2431343)
AA seq 361 aa
MEEYYMKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGA
HAEGADIYVTLEPCSHYGKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIE
VREGILADQAERLNEKFLHFMRTGLPYVTLKAAASLDGKIATSTGDSKWITSEAARQDAQ
QYRKTHQSILVGVGTVKADNPSLTCRLPNVTKQPVRVILDTVLSIPEDAKVICDQIAPTW
IFTTARADEEKKKRLSAFGVNIFTLETERIQIPDVLKILAEEGIMSVYVEGGSAVHGSFV
KEGCFQEIIFYFAPKLIGGTHAPSLISGEGFQSMKDVPLLQFTDITQIGRDIKLTAKPTK
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggaagagtattatatgaagctggccttagatcttgcgaagcagggcgaaggacagacc
gaatccaatccgctcgtcggcgctgttgtcgtaaaggacggacaaattgtcggaatgggc
gcccatttaaaatatggtgaagctcatgcagaagttcatgccatccatatggctggagca
catgcagagggtgccgacatttacgttacactcgaaccgtgcagccattacggaaaaaca
ccgccatgtgcagaattgattatcaactctggtatcaaaagagtgttcgtggcgatgaga
gatcctaatccgcttgtggctggaagagggatcagcatgatgaaagaagctggcattgag
gtaagggaaggcatcctggcagaccaggcggagaggctgaatgaaaaatttctgcacttt
atgaggacaggccttccgtacgtcacgctaaaagcggctgccagccttgacggcaagata
gctaccagcacgggtgacagcaaatggatcacgtcagaggctgcaagacaggatgctcag
caatacaggaaaacacaccaaagcattttagtcggagttggcacagtgaaagccgacaat
ccgagcttaacctgcagactgccgaatgtaacaaaacagccggttcgggtcatacttgat
accgtactctcgattcctgaggacgctaaagtgatttgcgatcaaatagcgccgacatgg
atttttacgacggcacgcgcagacgaggaaaagaaaaaacggctttcagctttcggagtg
aacatatttacacttgaaaccgagcgcattcaaattcctgatgttttgaagatcctagcg
gaagaaggcatcatgtcggtgtatgtggaaggcggttcagctgttcacggaagctttgtc
aaagaaggctgttttcaagaaatcatcttctattttgcccctaaactaatcggaggaacg
catgctcccagcttaatctccggtgaaggttttcaatcaatgaaagatgtccccttatta
caattcactgatataacccaaatcggccgtgatatcaaactgacggcaaaaccgacaaag
gaatag

DBGET integrated database retrieval system