KEGG   Bacillus subtilis subsp. subtilis 168: BSU23490
Entry
BSU23490          CDS       T00010                                 
Symbol
pupG
Name
(RefSeq) purine nucleoside phosphorylase 1
  KO
K03783  purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU23490 (pupG)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU23490 (pupG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     BSU23490 (pupG)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 938731
NCBI-ProteinID: NP_390230
Pasteur: BG11330
UniProt: P46354 A0A6M3ZDN2
LinkDB
Position
complement(2446418..2447233)
AA seq 271 aa
MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHA
GQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFR
AGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKG
VYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILD
QPLSHDEVMEVTEKVKAGFLKLVKAIVAQYE
NT seq 816 nt   +upstreamnt  +downstreamnt
ttgaaggacagaattgaacgcgcagccgcttttattaaacaaaacctgccggaatctcca
aagatcggccttattttaggctcaggtcttggcattttggcggacgaaatcgaaaatccg
gtcaagctgaaatatgaagatatacctgaattcccggtatctactgttgaagggcatgcc
ggacagcttgtgcttggcactcttgaaggagtttccgtcattgcaatgcagggccgcttt
catttttatgaaggctactcaatggagaaagtcacattccctgtacgcgtgatgaaagcg
ctcggtgtggaagcgttgatcgtgacaaatgccgcaggcggtgtcaacactgaattccgt
gcgggagatttaatgattattaccgatcatatcaactttatgggaacaaacccgttaatc
gggccaaacgaagcagatttcggcgccagatttccagatatgtcttcagcctatgacaaa
gatctgtccagcctggctgaaaagattgcgaaagaccttaatatcccaattcaaaaaggc
gtgtacactgctgtgacaggaccttcttacgaaacaccggcagaagtccgtttcttaaga
acgatgggctctgatgcagtcggcatgtctactgttccggaagtcattgtagcgaatcat
gcgggaatgcgggttcttggcatttcctgcatctctaacgcggcagccggaattctggat
cagcctttaagtcacgatgaagttatggaagtgaccgaaaaagtaaaagctggattctta
aagcttgttaaagcgatcgtcgctcagtacgaataa

DBGET integrated database retrieval system