KEGG   Bacillus subtilis subsp. subtilis 168: BSU24260
Entry
BSU24260          CDS       T00010                                 

Gene name
yqxC
Definition
(RefSeq) rRNA methyltransferase YqxC
  KO
K06442  23S rRNA (cytidine1920-2'-O)/16S rRNA (cytidine1409-2'-O)-methyltransferase [EC:2.1.1.226 2.1.1.227]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU24260 (yqxC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.226  23S rRNA (cytidine1920-2'-O)-methyltransferase
     BSU24260 (yqxC)
    2.1.1.227  16S rRNA (cytidine1409-2'-O)-methyltransferase
     BSU24260 (yqxC)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BSU24260 (yqxC)
   23S rRNA modification factors
    BSU24260 (yqxC)
SSDB
Motif
Pfam: FtsJ S4
Other DBs
NCBI-GeneID: 938651
NCBI-ProteinID: NP_390306
Pasteur: BG10308
BSORF: BG10308
UniProt: P19672 A0A6M3ZDI6
LinkDB
Position
complement(2522871..2523716)
AA seq 281 aa
MTSKKERLDVLLVERGLAETREKAKRAIMAGIVYSNENRLDKPGEKIDRDLPLTVKGNPL
RYVSRGGLKLEKALKEFPVSVKDKIMIDIGSSTGGFTDCALQNGAKQSYAVDVGYNQLAW
KLRQDERVVVMERTNFRYATPADFTKGMPEFATIDVSFISLRLILPVLRTLLVPGSDCMA
LVKPQFEAGRESVGKKGIVRDPKVHADVLKRMISFSAAEGYICKGLSFSPITGGDGNIEF
LLHLHWPGEGQEGQELPEEEIMRVVEEAHKTLKEKKADVPE
NT seq 846 nt   +upstreamnt  +downstreamnt
atgacgtcaaagaaagaacgattagatgtattattagtggaaagagggctggcggaaacg
cgtgaaaaagccaaaagagccattatggcggggatcgtctattcaaacgaaaaccgcttg
gacaagcctggagaaaaaattgaccgcgaccttccgttaactgtcaaaggaaacccgctg
aggtatgtgagcaggggcggcttaaagctcgaaaaagcgttgaaggaatttcccgtctct
gtcaaagataaaattatgattgatattggctcctccaccggcggttttacggactgcgct
ttgcaaaatggagctaaacagtcatacgctgtggatgtaggctataatcagcttgcatgg
aagcttagacaggatgaacgggtcgtcgtgatggaacggacgaactttcgttatgcaaca
ccggcagactttacaaagggcatgccggagtttgccacaattgatgtgtcctttatttca
ctgcggctcatcctgcctgtcctaaggactttgctcgtaccgggcagcgactgcatggct
ttagttaagcctcagtttgaagcgggacgggaatccgtcggcaaaaaagggattgttaga
gatcctaaagtgcatgctgatgtgctcaagcgaatgatcagtttttctgccgctgaaggc
tatatctgtaaaggcttgtcattttctccaatcacgggaggagacggaaatattgagttt
ctccttcatttgcattggccgggagagggacaggaaggccaggaactgccggaagaagag
atcatgcgcgttgtagaagaagcacataagacgttaaaagaaaaaaaagcagatgtaccg
gaataa

DBGET integrated database retrieval system