KEGG   Bacillus subtilis subsp. subtilis 168: BSU24720
Entry
BSU24720          CDS       T00010                                 

Gene name
comGB
Definition
(RefSeq) ComG operon protein 2
  KO
K02244  competence protein ComGB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU24720 (comGB)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU24720 (comGB)
SSDB
Motif
Pfam: T2SSF
Other DBs
NCBI-GeneID: 938527
NCBI-ProteinID: NP_390352
Pasteur: BG10484
BSORF: BG10484
UniProt: P25954
LinkDB
Position
complement(2557983..2558954)
AA seq 323 aa
MTAGGYTLLDGLRLMELQMNKRQAADLTDSVTCLREGAPFYQVLKSLSFHKEAVGICYFA
ETHGELPASMIQSGELLERKIAQADQLKRVLRYPLFLIFTVAVMFYMLQSIIIPQFSGIY
QSMNMETSRSTDMLFAFFQHIDLVIILLVLFTAGIGIYYWLVFKKKSPARQMLICIRIPL
VGKLVKLFNSYFFSLQLSSLLKSGLSIYDSLNAFKHQTFLPFYRCEAEQLIERLKAGESI
ESAICGSLFYETDLSKVISHGQLSGRLDRELFTYSQFILQRLEHKAQKWTGILQPMIYGF
VAAMILLVYLSMLVPMYQMMNQM
NT seq 972 nt   +upstreamnt  +downstreamnt
atgactgcgggcggatatacacttctggatggattacgcctgatggaacttcagatgaat
aagaggcaggcggctgacttgactgattcggtcacttgtttgagggaaggggctccgttt
tatcaagtactaaagagtttgtcatttcataaggaagccgtaggtatttgttattttgct
gaaacacatggtgaactgcctgcttcaatgatccagagcggagagctgctggaacgaaaa
attgcacaggcagaccagctgaaaagagtgctgcgctatccgcttttcctcatctttacg
gtcgctgtcatgttttatatgttacagtccatcatcattcctcagttttccggtatctat
caatcgatgaatatggaaacctcacgttcaaccgatatgctttttgctttttttcagcat
attgatcttgtgatcattttgcttgttctttttacagcaggtatcgggatttattattgg
cttgtgtttaagaaaaaatcacctgcccggcaaatgctgatttgtatcaggattcctttg
gttggaaagcttgtaaagctgtttaacagctactttttttctttgcagctaagcagcctt
ttaaaatcaggcctctcaatttatgacagccttaatgcatttaaacatcaaacgtttctc
cctttctaccgctgcgaggctgaacaattgattgaacggctaaaagccggtgagtcaatt
gaatccgctatttgtggaagccttttttatgaaactgatttatcaaaagtcatatctcac
ggccagctgagcggccgattggatcgggagcttttcacatacagccaattcatattacag
cggctggaacacaaagcgcaaaaatggacaggcatccttcagccaatgatttatggattt
gttgcagcgatgatcttacttgtgtatttatctatgcttgtgcctatgtatcagatgatg
aatcaaatgtga

DBGET integrated database retrieval system