KEGG   Bacillus subtilis subsp. subtilis 168: BSU24960
Entry
BSU24960          CDS       T00010                                 
Symbol
pstBA
Name
(RefSeq) phosphate import ATP-binding protein PstB 2
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU24960 (pstBA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU24960 (pstBA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BSU24960 (pstBA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BSU24960 (pstBA)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 RsgA_GTPase AAA_15 NB-ARC AAA_16 G-alpha Adeno_IVa2 AAA_18 AAA_33 Rad17 AAA_30 AAA_23 Spore_III_AA AAA_14 NACHT AAA_24 AAA_5 AAA ATPase_2 AAA_25 RNA_helicase PRK AAA_11
Other DBs
NCBI-GeneID: 938198
NCBI-ProteinID: NP_390375
Pasteur: BG11378
BSORF: BG11378
UniProt: P46341 A0A6M3ZDU7
LinkDB
Position
complement(2578003..2578812)
AA seq 269 aa
MSEQMVKEKPERAVIVPKQNHVLEVKDLSIYYGNKQAVHHVNMDIEKNAVTALIGPSGCG
KSTFLRNINRMNDLIPSARAEGEILYEGLNILGGNINVVSLRREIGMVFQKPNPFPKSIY
ANITHALKYAGERNKAVLDEIVEESLTKAALWDEVKDRLHSSALSLSGGQQQRLCIARTL
AMKPAVLLLDEPASALDPISNAKIEELITGLKREYSIIIVTHNMQQALRVSDRTAFFLNG
ELVEYGQTEQIFTSPKKQKTEDYINGKFG
NT seq 810 nt   +upstreamnt  +downstreamnt
atgtctgaacaaatggtaaaagaaaaacctgagcgagctgttattgttccgaagcagaac
cacgtgcttgaggtcaaagatctgtccatttattacggaaataaacaagccgttcatcat
gtaaacatggatattgaaaaaaatgcggtgactgctttaattgggccgtcgggatgcgga
aaatctacttttttgagaaatattaaccgaatgaacgatttaattccatctgcaagagcg
gaaggtgaaatcctttatgagggattaaatatattgggcggcaatattaacgttgtcagc
ttgagaagagaaatcggaatggttttccaaaaaccaaatccatttccgaaatcgatctat
gcgaatatcacacatgcattgaaatatgccggagagcggaataaagctgttttagatgaa
attgtggaagaaagtttaacaaaagcagcgctctgggatgaggtgaaggatcgtttacat
tcatccgcactctcgttatccggcggccagcagcagcgtttatgcatcgcgagaacgctt
gcgatgaagccggctgttcttctgcttgatgaaccagcttcagcgcttgatccgatttca
aatgcaaaaatagaggaattaattacaggattgaaaagagaatactcaattattattgtc
acgcacaatatgcagcaggctctgcgggtttctgaccggacggcattctttttaaacggc
gagcttgtagaatacggacagaccgaacagattttcacgagtccgaaaaagcaaaagaca
gaggattatattaacgggaaattcggatag

DBGET integrated database retrieval system