KEGG   Bacillus subtilis subsp. subtilis 168: BSU26720
Entry
BSU26720          CDS       T00010                                 
Symbol
azlB
Name
(RefSeq) transcriptional regulator AzlB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AsnC_trans_reg HTH_24 HTH_AsnC-type HTH_20 MarR
Other DBs
NCBI-GeneID: 937625
NCBI-ProteinID: NP_390549
Pasteur: BG11914
UniProt: O07920 A0A6M4JK90
LinkDB
Position
complement(2729753..2730226)
AA seq 157 aa
MGIMLDETDKAILRDLQEDASISNLNLSKKIGLSPSACLARTKNLVEAGIIKKFTTIVDE
KKLGIEVTALALINLSPLNRETIHSFLEDINKFPQVQECYTLTGSHDYMLKIVAKDMESY
RNFIIDSLMQNPAISGVDTSIVMSTEKRTVSVPIDEM
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggtattatgcttgacgaaactgataaggccatcttaagagatttgcaggaagatgct
tcaatatcaaatttaaatttatctaagaaaattgggctttcaccatcagcttgccttgca
agaacaaagaacctagtagaagcaggtataattaaaaagtttacgactattgttgatgag
aaaaaacttggaatcgaagtcacagcactagctctcatcaacttatcacccttaaatagg
gagacaattcattcatttttagaggatataaacaaattcccacaggttcaagaatgctac
acacttacaggaagccatgactatatgcttaagattgtggcgaaggacatggagagttat
cggaattttatcattgattcattaatgcagaaccctgctattagtggagttgacacaagc
atagtcatgagtacagaaaaaagaactgtcagtgtgccaattgatgaaatgtag

DBGET integrated database retrieval system