KEGG   Bacillus subtilis subsp. subtilis 168: BSU26970
Entry
BSU26970          CDS       T00010                                 
Symbol
adhB
Name
(RefSeq) zinc-type alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00071  Fatty acid degradation
bsu00350  Tyrosine metabolism
bsu00620  Pyruvate metabolism
bsu00625  Chloroalkane and chloroalkene degradation
bsu00626  Naphthalene degradation
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU26970 (adhB)
   00620 Pyruvate metabolism
    BSU26970 (adhB)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU26970 (adhB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU26970 (adhB)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BSU26970 (adhB)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSU26970 (adhB)
   00626 Naphthalene degradation
    BSU26970 (adhB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSU26970 (adhB)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     BSU26970 (adhB)
SSDB
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N FtsJ Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 937604
NCBI-ProteinID: NP_390574
Pasteur: BG11902
BSORF: BG11902
UniProt: O06012 A0A6M3ZEA7
LinkDB
Position
2753452..2754588
AA seq 378 aa
MKAVTYQGIKNVVVKDVPDPKIEKSDDMIIKVTSTAICGSDLHLIHGFIPNMQEDYVIGH
EPMGIVEEVGSGVTKLKKGDRVIIPFNIACGECFFCKNQLESQCDQSNDNGEMGAYFGYS
GQTGGYPGGQAEYLRVPFANFTHFKIPESCEEPDEKLSVIADAMTTGFWSVDNAGVKKGD
TVIVLGCGPVGLFAQKFCWLKGAKRVIAVDYVNYRLQHAKRTNKVEIVNFEDHENTGNYL
KEITKGGADVVIDAVGMDGKMSDLEFLASGLKLHGGTMSALVIASQAVRKGGTIQITGVY
GGRYNGFPLGDIMQRNVNIRSGQAPVIHYMPYMFELVSTGKIDPGDVVSHVLPLSEAKHG
YDIFDSKMDDCIKVVLKP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgaaggcagtaacgtatcaaggcattaaaaatgttgttgtcaaagatgtccccgatcca
aagattgaaaaatccgatgacatgattatcaaagtcaccagtacagccatttgcggatca
gatttacatttaatccatggattcattccgaatatgcaagaagactatgtcatcggccat
gaaccgatgggaatcgtcgaagaagttggttctggggtgactaaactaaaaaagggagat
cgggtaattattccctttaatatagcatgcggggaatgctttttttgtaaaaaccagctg
gaaagccaatgtgatcagtctaatgacaatggggaaatgggtgcttatttcggctattca
gggcaaactggcggttatccaggcgggcaagctgaatatttaagagtgccgtttgcgaat
tttacccattttaaaatccctgaatcttgtgaggaacccgatgagaaattaagcgtgatt
gccgatgccatgaccaccggcttttggagtgtggataatgccggcgtaaaaaaaggcgat
acagttatcgttctcggctgcggaccagtcggcctgtttgctcaaaagttttgttggcta
aaaggcgcaaaacgcgtcatagcagttgactatgtaaactatcgcttacagcatgcgaaa
cgtacaaacaaagtagaaatcgttaattttgaagaccatgagaatacagggaattattta
aaggaaatcacgaaaggcggagcggatgtagtcattgacgctgttgggatggatggtaaa
atgagcgatctcgagttccttgccagcggcttaaagcttcatggcggaacgatgagtgca
ttggtcattgcttcccaagctgttcgcaaaggaggaaccatacaaattacaggtgtgtat
ggaggcagatataacggttttccgttaggagatattatgcagcgaaacgtcaatatacgc
tctggacaggctccagtgatccactatatgccgtacatgtttgaactagtatcgacaggc
aaaattgatccgggagatgttgtcagccatgtcctgccgcttagtgaagccaagcatggc
tatgacatttttgattcaaaaatggatgattgtatcaaagttgtgttaaagccttaa

DBGET integrated database retrieval system