KEGG   Bacillus subtilis subsp. subtilis 168: BSU29040
Entry
BSU29040          CDS       T00010                                 

Symbol
ytbD
Name
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 936655
NCBI-ProteinID: NP_390782
Pasteur: BG13825
BSORF: BG13825
UniProt: O34367 A0A6M4JN14
LinkDB
Position
2968824..2970014
AA seq 396 aa
MTSANKSNIPALLALAVSAFAIGTTEFISVGLLPLIADDLDIPVTTAGLTVSLYALGVTF
GAPILTSLTSSMSRKTLLLWIMFIFIAGNTMAATASSIGILLAARVISAFSHGVFMSIGS
TIAADIVPEDKRASAISIMFTGLTVATVTGVPFGTFIGQQFGWRFAFMVIIAVGIIAFIT
NGILVPSKLRKGTKTTMRDQLKLVTNSRLLLLFVITALGYGGTFVVFTYLSPLLQEVTGF
KAGTVAVILLGYGIAIAIGNMIGGKLSNRNPIAALFYMFIVQAIVLFVLTFTAPYQAAGL
ITILCMGLLAFMNVPGLQVYVVMLAERFVPSAVDVASAMNIAAFNAGIALGSYLGGVITD
SIGLIHTAWIGGLMVVGAVILTGWSRLMEKRDRQEA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgacttcagccaataaaagcaatattcctgcactactggctttggccgtaagtgcattc
gcaatagggacaactgaatttatcagtgtcggccttttgccgctcattgctgatgacctg
gatattcccgtcacgacagcaggattgaccgtttccctttatgcgctcggcgttacattt
ggggcacctatattaacttcattgacctcaagcatgtcacgtaagacactattgctttgg
atcatgtttatttttattgccggtaatacgatggcagcaaccgcttcaagcatcgggatt
ttactagcagcacgtgtgatatcggcattttcgcacggtgtgtttatgtcgatcggttcg
acaatcgcagcggatattgtcccggaggataaaagggctagcgcgatttcaattatgttt
actggcctcactgtggcaactgtaaccggagttccttttgggacatttatcggccagcag
ttcggctggcgtttcgcctttatggtcattatcgccgtcggaatcattgctttcattaca
aatggcattcttgtaccgtccaaattacgaaaagggacgaaaacaacgatgcgggatcaa
ttgaagcttgtgacaaacagccggttattgcttttatttgtcattacagcgcttggatac
ggaggaacattcgttgtgttcacgtatctgtctcccctgcttcaggaagtaacaggcttc
aaagccgggactgttgcagtgattctgctcggatacggaatagctattgctatcggcaat
atgattggcggaaagctgtcaaaccgaaatccgattgccgctttattctatatgtttatc
gtacaggcaatcgttctattcgtactgacatttacagccccgtatcaagcagcagggctc
attaccattctctgtatgggattgctggcctttatgaacgtgcccggccttcaggtgtat
gtcgtcatgctggctgagcgttttgtcccgagtgcagttgacgtcgcatccgcgatgaat
atcgctgcctttaatgcagggatcgcgcttgggtcataccttggcggtgtgatcaccgat
tcaatcggattgattcataccgcttggataggcggattaatggtggtcggtgcagtcatt
ttaacaggctggagccgcttgatggaaaaacgagatcggcaggaagcctga

DBGET integrated database retrieval system