KEGG   Bacillus subtilis subsp. subtilis 168: BSU29260
Entry
BSU29260          CDS       T00010                                 
Symbol
ytpI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YtpI Phage_holin_3_6
Other DBs
NCBI-GeneID: 937370
NCBI-ProteinID: NP_390804
Pasteur: BG13902
BSORF: BG13902
UniProt: O34922 A0A6M4JNP8
LinkDB
Position
2996980..2997282
AA seq 100 aa
MLVLVFLIGLSACFYVYYKVKGVRAKPSLAKEICSAKSSMALGSLVLFYGLNQMILFHSV
LTLVIGGIFIVIGAGSAWAGYKAFRHYNPLHAKEAERDHA
NT seq 303 nt   +upstreamnt  +downstreamnt
atgctggttcttgtttttttgattgggctttcagcctgcttttatgtgtactataaagta
aaaggcgtacgggcaaagccatctttggcaaaagaaatatgttcagcaaaatcaagcatg
gccttagggtcactagtcctgttctacgggcttaaccaaatgatattattccattcagta
ttaacgttagtaatcggcggtatctttatcgtcataggagcaggaagcgcttgggcaggt
tataaagccttcaggcattacaatccccttcacgccaaagaagctgaaagagatcacgcg
taa

DBGET integrated database retrieval system