KEGG   Bacillus subtilis subsp. subtilis 168: BSU29370
Entry
BSU29370          CDS       T00010                                 
Symbol
tcyK
Name
(RefSeq) L-cystine-binding protein TcyK
  KO
K16957  L-cystine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU29370 (tcyK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU29370 (tcyK)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   L-Cystine transporter
    BSU29370 (tcyK)
SSDB
Motif
Pfam: SBP_bac_3 NMT1 TcdB_toxin_midN DUF2969 YhfZ_C
Other DBs
NCBI-GeneID: 937359
NCBI-ProteinID: NP_390815
Pasteur: BG13885
BSORF: BG13885
UniProt: O34852 A0A6M3ZEZ4
Structure
LinkDB
Position
complement(3006600..3007412)
AA seq 270 aa
MKTKTAFMAILFSLITVLSACGAGSQTTGAGQKKVQTITVGTGTQFPNICFIDEKGDLTG
YDVELIKELDKRLPHYKFTFKTMEFSNLLVSLGQHKVDIVAHQMEKSKEREKKFLFNKVA
YNHFPLKITVLQNNDTIRGIEDLKGKRVITSATSNGALVLKKWNEDNGRPFEIAYEGQGA
NETANQLKSGRADATISTPFAVDFQNKTSTIKEKTVGNVLSNAKVYFMFNKNEQTLSDDI
DKALQEIIDDGTLKRLSLKWLGDDYSKEQY
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaaaacgaaaacagcattcatggcaatattattttcgcttataacagttctgtcagct
tgcggtgcaggcagtcaaacgacgggagccgggcaaaagaaggtacagacgatcacggtc
ggaactggaacccaatttccgaatatttgctttatcgatgaaaaaggcgatttaaccggt
tatgatgtcgaactgatcaaagagcttgataagcgcctgccacattataaattcacattt
aaaacgatggaattttccaacctgcttgtcagcctcggacagcataaagtcgatatcgtg
gcacatcaaatggagaaaagcaaagagcgtgagaaaaaatttctgtttaacaaggttgct
tacaaccattttcctttaaaaattactgtgcttcaaaataacgatacgatccgtggaatt
gaagacttaaaaggaaaacgggtgattacgagtgcaacctccaacggagcgcttgtactg
aaaaaatggaatgaggataatggacggccgtttgagattgcctatgagggccaaggcgca
aatgagactgcgaatcagctgaaatcggggcgtgcggacgcaacgatctcaacgcctttt
gcagtagactttcaaaacaagacgagcactattaaagaaaaaaccgtcggtaatgtgctt
tcaaatgccaaagtgtattttatgtttaacaaaaatgaacaaacgttaagtgacgatatt
gataaagccttacaggaaatcattgatgacggaacgttgaaaaggctcagtttgaaatgg
cttggtgacgactattccaaagagcagtattag

DBGET integrated database retrieval system