KEGG   Bacillus subtilis subsp. subtilis 168: BSU30180Help
Entry
BSU30180          CDS       T00010                                 

Gene name
ytbQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase RmlD_sub_bind NAD_binding_10 3Beta_HSD Sacchrp_dh_NADP GDP_Man_Dehyd Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 937270
NCBI-ProteinID: NP_390896
Pasteur: BG11787
BSORF: BG11787
UniProt: P53560
LinkDB All DBs
Position
complement(3088388..3089149)
Genome map
AA seq 253 aa AA seqDB search
MKKVLIAGGNGVIGRLLAEGLISDYEVTVLDKDHFDGKASSIQADAANYEELLKKIPKDT
DAILNLLAVKIKYDIMDIAEFEKMTDVFYRASYYLCRAAAELGIQKLVFASSNHVTDVYE
KDGRSLLGREITTSDYPLSKNLYGVLKLTSEQIGHLFYLENKLSVINLRIGTVVTDEMDT
LHEKERTKKTLLSHPDLLSIFKAAIETNIRYGTYYAVSDNPGRPWSIESAVNELGFSPQI
NTAELLNEEENGA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaagtgctgatcgccggcggaaatggtgtgattgggagactgcttgctgaaggg
cttatttcagactatgaagtgactgtgcttgataaagatcatttcgatggcaaagcctct
tccattcaggctgacgcggcaaattatgaggagctgttgaagaagattccaaaagatacc
gatgccatcttgaatttactcgctgtgaaaatcaaatacgatattatggacatcgctgag
tttgaaaaaatgacggatgttttctatagggcaagctattatctgtgccgtgcggcagcg
gagctcggcattcaaaagctcgtgttcgccagcagcaatcatgtcacagatgtatatgaa
aaagacgggcgctcgctcttaggacgggaaatcacaacaagcgattatccgctgtcaaaa
aacttgtacggtgtattaaagctgacctctgaacagatcggccatttgttttatttggaa
aataagctatcagtaatcaaccttcgaatcggaacagtcgtgacagatgaaatggatacg
ctgcatgaaaaagaacggacgaaaaagacactgctttctcaccccgatctgctgtcgatt
ttcaaagccgccattgagaccaacatccggtatggcacttattacgccgtctctgataat
ccgggccggccatggtccattgaatctgccgtgaatgaacttgggttttcgccacaaatc
aatacggctgaacttctgaacgaggaggagaacggagcataa

DBGET integrated database retrieval system