KEGG   Bacillus subtilis subsp. subtilis 168: BSU32940Help
Entry
BSU32940          CDS       T00010                                 

Gene name
yusV
Definition
(RefSeq) siderophore transport system ATP-binding protein YusV
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32940 (yusV)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BSU32940 (yusV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_16 SMC_N AAA_29 ABC_ATPase AAA_30 RsgA_GTPase AAA_23 AAA_25 AAA_33 AAA_28 AAA_5 NACHT SRP54 AAA AAA_19 AAA_18 Viral_helicase1 DUF2891 Rad17 AAA_22 Mg_chelatase RNA_helicase Zeta_toxin AAA_27 ATP-synt_ab ATPase_2
Motif
Other DBs
NCBI-GeneID: 935921
NCBI-ProteinID: NP_391173
Pasteur: BG14034
BSORF: BG14034
UniProt: O32188
LinkDB All DBs
Position
complement(3379112..3379939)
Genome map
AA seq 275 aa AA seqDB search
MGMSAISTETLSLGYGDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGG
SVLLEGRAIAKLPTKEVAKELAILPQGPSAPEGLTVHQLVKQGRYPYQNWLKQWSKEDEE
AVERALKATKLEDMADRAVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEI
LDLLFELNEKEDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEGRPEEVITCDLVQNVFS
MNCQVTQDPLFGTPLCIPHGRGRCIVQEAAFTSHG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgagtgcaatttctacagaaacgctgagcttaggatacggggatgccgttatt
attgatgagttgaatttaacaattcccaaaggtgaaattaccgtatttattggcagcaat
ggctgcggaaaatcgacacttttacgttcattagcgcgcctgatgaagccgagaggcggt
tcagtgctgctggaaggaagagcgattgccaagcttccgacgaaggaagtcgcaaaagag
ctcgcaatcctgccccaaggtccttcggctccagaggggctgacggtgcatcagctggtg
aagcaaggaagatatccttaccaaaactggctgaagcagtggtcaaaagaggatgaggaa
gcagttgaaagagcgcttaaagcaacaaagcttgaggacatggctgaccgtgccgttgat
tctttgtcaggcggacagcgccagcgggcttggatcgcgatgacgcttgcccaggaaacg
gatatcatccttcttgacgagccgacgacgtatttagacatgacgcatcaaattgaaatt
cttgatttgctgtttgagctgaatgaaaaggaagaccggacgattgttatggttctccat
gacttaaacttggcgtgccgctatgcgcatcatcttgtggccataaaagataaacggatt
tatgcagaaggccgtccggaagaggtcatcacttgtgatcttgtgcaaaatgtgttttct
atgaactgtcaggttacacaggacccgctcttcggaacgcctctttgcattcctcatggc
aggggcagatgcattgtccaggaagcggctttcacatcacatggataa

DBGET integrated database retrieval system