KEGG   Bacillus subtilis subsp. subtilis 168: BSU33670
Entry
BSU33670          CDS       T00010                                 
Symbol
rghRB
Name
(RefSeq) HTH-type transcriptional regulator RghRB
  KO
K22299  HTH-type transcriptional regulator, competence development regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU33670 (rghRB)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU33670 (rghRB)
SSDB
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_26 HTH_25 MarR_2 HTH_37 YycC HTH_DeoR HTH_60 HTH_11 MarR
Other DBs
NCBI-GeneID: 938539
NCBI-ProteinID: NP_391247
Pasteur: BG14070
UniProt: O32237 A0A6M3ZGE3
LinkDB
Position
3457104..3457523
AA seq 139 aa
MSPFGQQLRELRRARKLTVNQLAVYSGISSATISKIENGKRGTPKPATIKKLAAVLKVPY
ENLMAAAGHIQAFPEEIREASEGYQSVYEIYQTAVTRGAEHLPIFNSQKWEHLSKQDIEN
LSKYFDFLSSEAKKRASSS
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtcaccgttcggacagcaattacgggagctgcgccgcgcccgcaaactgacagtgaat
cagcttgcggtgtactcaggcatcagctcggccaccatttcaaaaattgaaaacggcaaa
cgcgggacgccaaaacccgccacgattaaaaaactggcagccgtcctgaaagtgccgtac
gaaaacctaatggccgccgcaggccatattcaggcctttcctgaagaaatccgcgaagca
tctgaaggctatcaatccgtttatgaaatttaccagacggctgtcacacgcggagcggag
cacctcccgattttcaatagtcaaaaatgggaacatctctcaaagcaggatattgaaaat
ctcagcaaatacttcgattttttgtcttcagaagcaaaaaaacgcgcctcttcctcataa

DBGET integrated database retrieval system