Bacillus subtilis subsp. subtilis 168: BSU33790 Help Entry BSU33790          CDS       T00010                                  Symbol sdpR Name (RefSeq) transcriptional repressor SdpR   KO K26993   ArsR family transcriptional regulator, repressor of sdpIR and other operons Organism bsu  Bacillus subtilis subsp. subtilis 168 Brite KEGG Orthology (KO) [BR:bsu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bsu03000]     BSU33790 (sdpR) Transcription factors [BR:bsu03000]  Prokaryotic type   Helix-turn-helix    ArsR family     BSU33790 (sdpR) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HTH_5 HTH_20 HTH_24 MarR_2 HTH_11 TrmB HTH_28 HTH_Crp_2 MarR HTH_10 HTH_7 DUF4423 HTH_IclR Sigma70_r4 Sigma70_r4_2 TFIIE_alpha Rrf2 Fe_dep_repress HTH_23 HTH_DeoR HTH_37 UPF0122 HTH_38 ArsR PuR_N NUMOD1 Phage_rep_O TetR_N Motif Other DBs NCBI-GeneID:  936249 NCBI-ProteinID:  NP_391259 Pasteur:  BG14078 UniProt:  O32242 A0A6M4JP94 LinkDB All DBs Position complement(3467054..3467326) Genome browser AA seq 90 aa AA seqDB search MNNVFKAISDPTRRKILDLLKGGDMTAGDIAEHFNISKPSISHHLNILKQAEVISDHRKG QFIYYSLNTTVLQDSINWMLNFINKGDNDL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataatgttttcaaagctatatcagatccaacaaggagaaaaattttggatttgtta aaaggaggggatatgactgcgggagatattgctgagcattttaatatcagcaaaccgagt atttcgcaccacttgaatattttaaagcaagcggaagtcataagtgaccatcgcaaagga caatttatttattactctctaaatacaacagtacttcaagactcaataaattggatgctt aactttataaataaaggggataacgatttatga

DBGET integrated database retrieval system