KEGG   Bacillus subtilis subsp. subtilis 168: BSU34060
Entry
BSU34060          CDS       T00010                                 

Symbol
yvfU
Name
(RefSeq) transcriptional regulator
  KO
K02479  two-component system, NarL family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU34060 (yvfU)
Two-component system [BR:bsu02022]
 NarL family
  Unclassified
   BSU34060 (yvfU)
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4 Sigma70_r4_2 HTH_40 Glycos_transf_1 DUF2089
Other DBs
NCBI-GeneID: 938523
NCBI-ProteinID: NP_391286
Pasteur: BG12446
BSORF: BG12446
UniProt: O07019 A0A6M4JPC7
LinkDB
Position
complement(3495876..3496478)
AA seq 200 aa
MIRLFIAEDQRMLLGALGSLLDLEEDMTVIGQALNGEEALHAILKLEPDVCIMDIEMPVR
SGLNVAEELMKKGCVSKVIILTTFARPGYFERAVKAGAHGYLLKDGEIDDLADAIRKCVK
GKRVFSPELTFNMMRDENPLTVREQEILRLAALGKTTKDITLELYLSQGTVRNYISEIIQ
KLNAKNRTEAASIAEEKGWI
NT seq 603 nt   +upstreamnt  +downstreamnt
atgattcgtctgtttattgctgaggaccagcgaatgcttttaggcgctttgggatctttg
cttgatttagaagaggatatgacagtcatcggacaagcattaaacggggaagaggcgcta
catgctattttgaagctggagccggatgtatgcattatggacattgaaatgccggttcga
agcgggctgaatgtggcagaggaattaatgaaaaaaggctgcgtcagcaaggtcattatt
ttaaccacctttgcccgccccggatattttgaacgcgccgtaaaggccggtgcacatggc
tatctgctgaaagacggtgaaattgacgatctggccgatgccattcgaaaatgtgtaaag
ggaaaacgtgtcttcagccctgagctgacgtttaatatgatgcgagacgaaaatccgcta
accgttagagagcaagaaattctgaggcttgcggctttaggcaagacaacaaaagacatt
acgctggagctctatttatctcaaggcacagttcgaaactatatctcagaaatcatccaa
aagcttaatgcgaaaaatcggacagaagccgccagcatcgctgaggaaaagggctggatc
taa

DBGET integrated database retrieval system