KEGG   Bacillus subtilis subsp. subtilis 168: BSU36600
Entry
BSU36600          CDS       T00010                                 

Gene name
mta
Definition
(RefSeq) HTH-type transcriptional activator mta
  KO
K21743  MerR family transcriptional regulator, multidrug-efflux activator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU36600 (mta)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    BSU36600 (mta)
SSDB
Motif
Pfam: TipAS MerR_1 MerR MerR-DNA-bind
Other DBs
NCBI-GeneID: 936962
NCBI-ProteinID: NP_391541
Pasteur: BG12482
BSORF: BG12482
UniProt: P71039 A0A6M4JQ23
LinkDB
Structure
PDB: 
1R8D 1JBG

Position
complement(3764133..3764906)
AA seq 257 aa
MKYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQQILFFKEIGF
RLDEIKEMLDHPNFDRKAALQSQKEILMKKKQRMDEMIQTIDRTLLSVDGGETMNKRDLF
AGLSMKDIEEHQQTYADEVRKLYGKEIAEETEKRTSAYSADDWRTIMAEFDSIYRRIAAR
MKHGPDDAEIQAAVGAFRDHICQYHYDCTLDIFRGLGEVYITDERFTDSINQYGEGLAAF
LREAIIIYCDHQENPRP
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaaatatcaagttaaacaagtggcggagatatcaggcgttagcattcggacgcttcat
cactatgacaatattgagcttctgaatccttcagcgcttactgatgctgggtatcgtttg
tacagtgacgcagacctggaaagactgcaacagattttatttttcaaggaaatcgggttt
cgtctggatgagattaaagagatgctggatcatccgaattttgaccggaaagcggcactt
cagtcgcaaaaggagatattgatgaagaaaaaacaaagaatggatgagatgattcaaaca
attgacaggacgcttttgtccgttgatggaggggaaacgatgaataagagggatttattt
gccggattaagcatgaaagacattgaagagcaccagcagacatacgctgatgaagtcaga
aagctgtatggaaaggaaatcgcagaagaaacagagaaaaggacatctgcatactcggca
gatgattggcgcacgatcatggctgaatttgattcgatttacagacgaattgcggcgcga
atgaagcatgggcccgatgatgcagagattcaggccgctgtgggggcatttcgcgatcat
atttgccaatatcattacgattgcacactcgacattttcagaggactcggggaagtgtat
atcactgacgagcgatttaccgattcaatcaatcaatatggagaaggtcttgccgctttt
ttgcgggaggcaatcatcatttactgtgaccatcaggaaaacccccggccgtaa

DBGET integrated database retrieval system