KEGG   Bacillus subtilis subsp. subtilis 168: BSU38710
Entry
BSU38710          CDS       T00010                                 

Gene name
yxlA
Definition
(RefSeq) purine-cytosine permease YxlA
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU38710 (yxlA)
SSDB
Motif
Pfam: Transp_cyt_pur
Other DBs
NCBI-GeneID: 937405
NCBI-ProteinID: NP_391750
Pasteur: BG12548
BSORF: BG12548
UniProt: P94369 A0A6M3ZIJ6
LinkDB
Position
3971060..3972433
AA seq 457 aa
MKVERRTIEYIPNEERHGKAKDLFPVWFGANMHITTLVTGTIPVAMGLNLFWSVAAIICG
TLIGAIFMASHSAQGPQLGIPQMIQSRAQFGVIGAILPLFLVMFIYLGFFASSTILAAGT
LSSFVPIPGSWSIIGLSAVCFLLTIFGHDLIHKMQKILSWTSFAVFFAATILIFQLPIPA
GSWIPGAIDLPIFLVAVSAVATWQLAYAPYVADYSRYLPVKTPASKTFWYSYAGTSVSSI
WMMLLGALLTTSLPDFTANSGSQIVQLFGPFSFIMLIIVLFGQMAINVFNLYGAFMSTTT
TLEPFLKLKVTPKVRIIMILGVTLVGTVLSLLGQSNFMELFLNFIFFISYFLIPWTAINL
VDYYFVRHGKYQVKAMFDVNGPYGKVNWITTIAFVLSILLEIPFINTSFYIGPLAKMFGG
GDIAWIIGLAVPSVLYYVLMKPRLKKRAGYQEKLSSL
NT seq 1374 nt   +upstreamnt  +downstreamnt
ttgaaagtagaaaggcgaacgattgaatatattccgaatgaagaaagacatggtaaagcg
aaagatttatttcccgtatggttcggggctaatatgcatatcaccacgttagtgaccggc
acgattcccgttgcaatgggacttaatctgttttggagtgttgccgctattatttgcgga
accttaatcggtgccatatttatggcttctcattccgcgcaaggccctcagctaggcatc
ccgcaaatgattcaaagccgtgcccaattcggcgtaatcggagcgattcttcccctcttc
ttagtcatgtttatctaccttggtttcttcgcaagcagcacgattctggcggccggaacc
ttaagcagctttgttcccatcccgggatcatggagcattataggcttaagtgccgtatgt
tttttactcaccattttcggccatgatttgattcacaaaatgcaaaaaatcctttcttgg
acctcttttgctgtattttttgctgcaacgattctcatttttcaattgccgattccggca
ggcagctggatacccggagcgattgatctgccaattttcctagtggcagtcagcgcagtt
gcgacgtggcagcttgcctacgcgccgtatgttgccgattattcaagatatctgccagtt
aaaacaccggcttcaaaaacattttggtacagctatgcaggtacatctgtcagctccatc
tggatgatgctgctcggcgcattgctgacaacctcacttcctgactttacggcaaactca
ggcagccagattgtccaattgttcggtcccttctcgtttattatgctgatcattgtgcta
tttgggcaaatggcaatcaatgtttttaacctgtatggggctttcatgtccacgacaaca
acgctggagccgtttctgaaattaaaagtcacgcccaaagtcagaatcatcatgatcctg
ggtgtcacgcttgtcggcacagtcttaagcctactgggacagagcaattttatggaactg
tttttgaattttatctttttcatcagttatttcttaattccgtggacggcaatcaattta
gtcgattactacttcgtccgccacggaaagtatcaagtcaaagccatgttcgacgtaaac
gggccttatggaaaggtcaattggatcaccacaattgcgttcgttctgtctatcttgctg
gaaattccgtttatcaacacaagcttttacatcggaccgcttgccaaaatgtttggcggc
ggagacatcgcatggattatcggcttggccgtgccttctgtgctttactatgtattaatg
aaaccgcgtctgaaaaaacgggcggggtatcaagaaaagctgtcttctctctga

DBGET integrated database retrieval system