KEGG   Bacillus subtilis subsp. subtilis 168: BSU39230
Entry
BSU39230          CDS       T00010                                 

Gene name
wapA
Definition
(RefSeq) wall-associated protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RHS_repeat DUF6531 TGFb_propeptide DUF6281
Other DBs
NCBI-GeneID: 937525
NCBI-ProteinID: NP_391802
Pasteur: BG10797
BSORF: BG10797
UniProt: Q07833 A0A6M4JQQ0
LinkDB
Position
complement(4023544..4030548)
AA seq 2334 aa
MKKRKRRNFKRFIAAFLVLALMISLVPADVLAKSTEEENGNRIAADDPEETLQKEQTEEA
VPFDPKDINKEGEITSERTENTKLYYEGDGVYKQEVYLDPIHTKETPDADWEDISPELKE
STSKQVETENAILNSDFQKQMKNGLYATFEHNDHKVTYSLAEAKGPNKTSLTPKDTSADY
KTDSNEIVYPDVFPNIDLQTFTFNENIKEDLVLHQYNGYNTFTFQLKTDLQAKEQEDGSI
DFSDEKGKVVFSVPKPFMTDSKLDELSGEVERSDKVSYKLEKNEEGYLLHLTADENWLKD
PERVYPVSIDPSTSLSVSSDTFVMSAYPTTNYSASSQKWDANLKAYVLKTGYYDKTTGTN
YAFMKFNNLKPIQNMTVTKATLKTYVAHSYYGTKATGLWLDTVNSNYDNAKVTWNTKPAS
KNIGKADVHKGQWASYDVTAAVKSWNSGGANYGFKLHTNGNGKEYWKKLISSANSANKPY
IEVTYTIPKGNTPTIKAYHNGDSTGYFDISWKKVEGAKGYKVWIYNGKEYQAISAGNVTS
WSTKGKKIWPTSAEIASKRYKLHLDGKDGAELALDPSPVYKNSGGSYATSKNYWIGVSAI
FDQGEGAMSAPAKPVIPNVGKAQAPSAKGYNNGNATGYFDLSWKAVSGATGYKVQVFNGK
GFETLDLGNQTSWTTKGKKIWPTSAEIKAGKYALHLKDGSGAELPINPGPTYKNAGGDGA
KRNYSFKIIAYNKDGEAIASPAATPALPDIARPKNVTGYLYTNTKSSQTGYVNLIWEKVQ
NAKGYKVNIYNGKEYQSFDVGDADHWTTQNKNIWPTSEEIKAGSYKLHTDGKGGELALDP
SPVYNNANGNYKGKKNYSFTLVAYDANGETIPTAPFNPTFHEGAEFLGTEEYWSIIDIPS
GQLNGATGNVIVNEEDLSIDGRGPGLGLSRTYNSLDSSDHLFGQGWYADAETSVISTDGG
AMYIDEDATTHRFTKKADGTYQPPTGVYLELTETADQFILKTKDQTNAYFNKKGGKLQKV
VDGHNNATVYTYNDKNQLTAITDASGRKLTFTYDENGHVTSITGPKNKKVTYSYENDLLK
KVTDTDGTVTSYDYDSEGRLVKQYSANSTEAKPVFTEYQYSGHRLEKAINAKKETYVYSY
DADKKTLLMTQPNGRKVQYGYNEAGNPIQVIDDAEGLKITTNTKYEGNNVVEDVDPNDVG
TGKATESYQYDKDGNVTSVKDAYGTETYEYNKNNDVTKMKDTEGNVTDIAYDGLDAVSET
DQSGKSSSAAVYDKYGNQIQSSKDLSASTNILKDGSFEAQKSGWNLTASKDSGKISVIAD
KSGVLSGSKALEVLSQSTSAGTDHGYSSATQTVELEPNTTYTLSGKIKTDLAKSRAYFNI
DLRDKDQKRIQWIHNEYSALAGKNDWTKRQITFTTPANAGKAVVYMEVDHKDKDGKGKAW
FDEVQLEKGEVSSSYNPVQNSSFTSATENWNVSGASVDSEEGFNDDVSLKAARTSASQAG
SVTKQTVVLGQSANDKPVYLTLTGMSKASSVKFTDEKDYSLQANVTYADGSTGIYNAKFP
SGTQEWNRAAVVIPKTKPINKVDISILFQKSATGTVWFDDIRLIEGSLLTKSTYDSNGNY
VTKEEDELGYATSTDYDETGKKTSETDAKGEKTTYTYDQADQLTNMTLSNGTSILHSYDK
EGNEVSKTIRAGADQTYKFEYDVMGKLVKTTDPLGNVLASEYDANSNLTKTISPNGNEVS
LSYDGTDRVKSKSYNGTEKYIFTYDKNGNETSVVNKEQNTTKKRTFDNKNRLTELTDRGG
SQTWTYPSDSDKLKTFSWIHGDQKGTNQFTYNKLDQMIEMKDSTSSYSFDYDENGNVQTF
ITGNGGGTSFSYDERNLVSSLHIGDKNGGDILTESYEYDANGNRTTINSSASGKVQYEYG
KLNQLVKETHEDGTVIEYTYDGFGNRKTVTTIKDGSSKTVNASFNIMNQLTKVNDESISY
DKNGNRTSDGKFTYTWDAEDNLTAVTKKGEDKPFATYKYDEKGNRIQKTVNGKVTNYFYD
GDSLNVLYETDADNNVTKSYTYGDSGQLLSYTENGKKYFYHYNAHGDIIAISDSTGKTVA
KYQYDAWGNPTKTEASDEVKDNRYRYAGYQYDEETGLYYLMARYYEPRNGVFLSLDPDPG
SDGDSLDQNGYAYGNNNPVMNVDPDGHWVWLVVNAGFAAYDGYKAYKSGKGWKGAAWAAA
SNFGPGKIFKGASRAYKFTKKAVKITGHTRHGLNQSIGRNGGRGVNLRAKLNAVRSPKKV
IKQPNGATKYVGKKATVVLNKRGKVITAYGSSRAKGSKHVFHTHGKGNKSKRRR
NT seq 7005 nt   +upstreamnt  +downstreamnt
atgaaaaaaagaaagaggcgaaactttaaaaggttcattgcagcatttttagtgttggct
ttaatgatttcattagtgccagccgatgtactagcaaaatctacagaagaagagaatgga
aaccgtattgctgccgatgatccagaagaaactcttcagaaagaacaaactgaggaagct
gtaccttttgatccaaaagatataaacaaagagggtgagatcacctctgaaagaacagaa
aatacaaaactctattatgaaggtgacggtgtctataaacaggaagtataccttgatcct
attcatacaaaggaaacaccggatgccgactgggaagacatttctcctgagttaaaagag
tcgacaagcaaacaagtcgagacagagaacgctattttgaattcagattttcaaaagcaa
atgaagaacgggctttatgcgacttttgagcataatgaccataaggttacatattcacta
gcagaagcgaaaggcccgaataaaacttcacttactccgaaagatacctcagcagattat
aagactgacagtaatgagattgtgtatccggatgtgtttccgaatattgatcttcagact
ttcacattcaatgaaaacataaaagaagatttagtccttcatcagtataatggatacaac
acatttacatttcagttaaaaaccgatttgcaggctaaagaacaagaggatggatccatt
gatttttctgatgaaaaaggaaaagttgttttttctgtgcctaagccttttatgacggat
tcaaaactagatgagctttccggcgaggttgaacggtcagacaaagtcagctataagctg
gaaaagaatgaagaagggtatttgcttcatcttacggcagacgagaactggctgaaagac
ccagaacgcgtatatccagtatctatcgacccgtcaacttctttatctgtttcatcggat
acgtttgtcatgagtgcctacccgacgacgaactattcggcctcctcacaaaaatgggat
gctaatttaaaggcctatgtactgaaaacgggctattatgacaaaacaacaggcacaaac
tatgcgttcatgaaatttaacaacctaaagccaattcaaaatatgactgtcactaaagct
acattaaaaacatacgtagcccattcctattatggaacaaaggcaaccggcctttggctg
gatacggtcaacagcaattatgataatgcaaaagtgacatggaacaccaaaccggcatct
aaaaatatcggaaaagccgacgtccataaaggacagtgggcgagttatgatgtgaccgct
gctgtaaagtcatggaactccggcggggccaactatggatttaagcttcatacaaacgga
aacggcaaggaatattggaaaaaactaatttcttcagcgaactccgccaataaaccatat
attgaagtgacgtataccattccaaagggaaacacacctacaatcaaagcctatcacaac
ggcgattccactggttatttcgatatcagctggaaaaaggttgaaggcgcaaaaggatat
aaggtatggatttacaatggtaaggaatatcaagcgatttctgcaggcaacgtcacgtcg
tggagcacaaaaggtaaaaaaatctggcctacgagcgcagaaattgcctccaagagatat
aaactgcatctggacggcaaggatggagctgaattggcattagatccatccccggtctat
aagaattccggcggaagctatgctacaagcaaaaactattggattggcgtcagtgcgata
tttgaccaaggtgaaggagcgatgtccgcaccggcaaagcccgttatccctaatgtagga
aaagcacaagcaccgtcagcaaagggctacaataatgggaatgccacaggatacttcgac
ctttcttggaaagctgtatccggtgcaaccggctataaggttcaggtgttcaatgggaaa
ggctttgagacacttgatctcggaaatcagacgtcttggaccacaaaagggaaaaagatc
tggccgacaagtgcagaaatcaaggcgggaaaatatgctcttcacctaaaggacggaagc
ggagcagagctgccgatcaatcccggaccaacctataaaaacgccgggggagatggagcc
aaaagaaattactcgtttaaaattatcgcatacaacaaagacggcgaagccattgcatcc
ccggctgctaccccggcacttcctgatatcgctaggccaaagaatgtaactggctatttg
tatacaaatacaaaatcgagtcaaacgggttatgtgaatttgatatgggaaaaggttcaa
aatgcgaagggctataaagttaacatttacaacggtaaagaatatcagtcctttgatgtt
ggtgatgctgatcattggacaacccaaaataaaaacatctggccgacttctgaggaaatc
aaagccggaagctataagcttcatacagatggaaaaggcggggaattagccctcgatcca
tcacctgtctataacaatgcaaatgggaattacaaagggaagaagaattattctttcacg
cttgtcgcctatgatgcgaatggtgaaacgattccaacggcgccctttaacccaacgttc
catgaaggcgcagaattcctaggtacagaagagtactggtctatcattgatatcccaagc
ggccagttaaatggtgcgacaggcaatgtcattgtgaatgaagaagatttgtcaattgat
ggacgcggtccgggacttggcttatcgagaacctacaacagtcttgacagctctgatcac
ttatttggacaaggctggtatgctgatgcagaaacatctgtcatctcaacggatggcggg
gcaatgtatatcgatgaagacgctacgacacatcgattcacgaaaaaagccgatggcacg
tatcagccgccgaccggtgtatatcttgaattaacagaaacagctgatcagttcatatta
aaaacaaaggatcaaaccaacgcttatttcaataaaaaaggcggcaaactccaaaaggta
gtggatggccataacaatgcaactgtctatacttacaatgacaaaaatcaactgaccgcc
attacagatgcatcaggccgcaagcttacatttacctatgatgaaaacggccatgtgacg
tccatcacaggacctaagaataagaaagtcacctactcatatgagaatgatttgctgaag
aaggttacagatacagacgggactgtcacaagctatgactacgatagtgaagggcgcctt
gtcaaacaatattcagctaacagtaccgaagcaaagcctgtctttaccgaatatcagtat
agcggtcaccgtctcgaaaaagcgatcaacgctaaaaaagaaacatatgtctacagctat
gatgctgataaaaagacgcttctcatgacacagccaaatggccggaaagtacagtatggc
tataatgaagcgggaaatccgattcaggtcattgatgatgcggaagggttaaaaattaca
acgaatacaaagtatgaaggcaacaatgttgtagaagatgtagatccaaatgacgtcggc
accggaaaagcaacggaaagctatcaatatgacaaagatggcaacgttacgtcggttaaa
gatgcatatggaactgagacatacgaatacaacaaaaacaacgatgtcacaaagatgaag
gataccgagggcaatgtcacggatattgcttatgacggactggatgctgtatccgaaacc
gatcagagcggaaaatcatcgtcagcagctgtttatgataaatatggaaaccagattcaa
tcgagcaaagatttatcagcttcaactaatattttgaaagatggaagctttgaagctcaa
aaatccggctggaatctgactgcctctaaagacagcggcaaaatttcagtcatcgccgat
aaaagcggagttctttccggatcaaaggcattggaggtcttgagccaatcaacgtctgcc
ggaacagatcatgggtattcgtcagcaacacaaacagttgagctggagccgaatacaacc
tatacattaagcgggaaaatcaaaacagatcttgcgaaatcaagagcctattttaacatt
gatttgcgagacaaagatcaaaaacgaattcaatggattcacaatgaatacagtgcatta
gccggaaaaaatgactggacaaaacggcaaatcacttttacgactccagcgaatgcaggc
aaagctgttgtgtatatggaagtcgatcataaagataaagatggcaaaggaaaagcatgg
tttgatgaagtccagctggaaaaaggcgaagtatcatcaagctataacccagttcaaaac
agcagcttcacatcagcaacggaaaactggaatgtaagcggagcatccgttgattctgaa
gaaggctttaatgatgatgtatcattaaaagctgcccggaccagtgcgtcccaagccgga
tcagtaacaaaacaaaccgttgtcttagggcaaagcgcaaatgacaaaccggtttatctc
acactgacaggaatgtcgaaagcaagcagcgtcaaatttacagatgaaaaagactattct
ctgcaggcgaatgtcacttacgctgacggcagcacaggcatctacaatgcgaaattccct
tctggaacacaggaatggaaccgagcagctgtcgtcatccctaaaacaaagccgatcaat
aaagtcgatatcagtattctgttccaaaagagtgcgacaggcacagtctggtttgatgat
atccgtttgattgaaggaagccttctgactaaaagcacgtatgacagtaatggcaactat
gtgaccaaggaagaggacgaactaggttacgccacttcaactgattacgatgaaactggt
aagaaaacgtctgaaacagatgcaaaaggtgaaaaaacaacctatacgtatgatcaggca
gaccaattgacaaacatgacgctctctaacggcacgtctatccttcacagctatgataag
gaaggcaatgaggtaagcaaaaccatccgggcaggagcagatcaaacctataaattcgaa
tatgatgtcatgggcaagcttgtcaaaacaactgaccctctcggcaatgtgttagcaagc
gaatatgatgccaacagcaacctgaccaaaaccatttcaccaaatggcaacgaagtgtct
ctttcttatgatggaacagaccgggtgaaatcaaagtcgtataacggtacagaaaagtac
attttcacgtatgacaaaaatggaaatgaaacgtcggtcgtcaataaagagcagaacacc
acaaagaaacggacatttgacaacaaaaaccgtttaaccgaactgacagaccgcggcggc
agccaaacttggacatatcctagtgactccgataagctgaaaaccttctcgtggattcat
ggggaccaaaaaggaacgaatcaatttacgtataacaagctggatcaaatgattgagatg
aaagacagtacatcctcatattcatttgattatgatgaaaatggaaacgtccaaaccttt
attacgggcaacggcggcggaacaagtttttcatatgacgaaagaaaccttgtaagctcg
ctgcatatcggtgacaaaaacggcggagacattctgacggaaagctatgaatatgatgcc
aacggcaaccgcacaacgataaacagctcagcaagcggcaaggtgcaatatgagtatggg
aagctgaatcagcttgtcaaagaaacccatgaagacggtactgttattgaatacacatat
gatggattcggaaaccggaaaaccgttacaactataaaagacggctcaagcaaaacggtg
aacgcttccttcaacatcatgaaccagctgacaaaagtcaatgatgaaagcatctcttac
gataaaaacggcaaccgcacatccgacggcaaattcacatatacgtgggatgcagaagat
aacctgaccgccgttaccaaaaaaggcgaagacaagccattcgcaacatataagtatgac
gaaaaaggaaacagaatccaaaaaaccgtcaacggaaaagtcacgaactacttctacgac
ggagacagcttgaacgtcttgtatgaaacagacgcggacaacaacgtcacaaaatcatac
acgtacggagacagcggccagctgttatcctacacagaaaatggtaagaaatatttctat
cactacaacgctcacggcgacatcatcgcgatctcagacagcactggaaaaaccgttgcc
aagtatcaatacgacgcatggggaaatccaacaaaaaccgaagcaagcgacgaagtaaaa
gacaatcgctaccgctacgcaggctaccaatacgacgaagaaaccggcctgtactatctc
atggcccgctactacgagccaagaaacggcgtgttcctatcgctcgacccagacccgggc
agcgacggagattcattggatcagaatgggtatgcttatggaaataataacccagtgatg
aatgttgatccggacgggcattgggtatggcttgtggtaaatgccggatttgcagcctat
gatggatataaggcatataaatcaggtaaaggatggaaaggtgctgcttgggcagctgct
tctaattttggtcctgggaagatatttaagggtgctagtcgcgcctataagtttacgaag
aaggcagttaaaatcacaggtcatacaagacatggacttaatcaatctataggaagaaat
ggaggccgtggagtcaatttaagggccaaactgaatgctgtgcgaagccctaaaaaagta
ataaaacaacctaatggggcaacgaaatatgttggaaaaaaagctacagttgttttaaat
aaaaggggtaaagtaatcacagcttatggaagttcaagagctaagggttctaaacacgta
ttccatacacacggaaaaggaaataaatctaagagaaggcgttaa

DBGET integrated database retrieval system