KEGG   Bacillus subtilis subsp. subtilis 168: BSU39360
Entry
BSU39360          CDS       T00010                                 

Gene name
hutU
Definition
(RefSeq) urocanate hydratase
  KO
K01712  urocanate hydratase [EC:4.2.1.49]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU39360 (hutU)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.49  urocanate hydratase
     BSU39360 (hutU)
SSDB
Motif
Pfam: Urocanase_C Urocanase Urocanase_N
Other DBs
NCBI-GeneID: 937542
NCBI-ProteinID: NP_391815
Pasteur: BG10668
BSORF: BG10668
UniProt: P25503 A0A6M3ZI34
LinkDB
Structure
PDB: 
2FKN

Position
4043574..4045232
AA seq 552 aa
MTDVKKSIRANRGTELECLGWEQEAVLRMLRNNLDPEVAEKPEDLIVYGGIGKAARDWDA
FHAIEHSLKTLKNDETLLVQSGKPVGMFRTHPQAPRVLLANSVLVPKWADWEHFHELEKK
GLMMYGQMTAGSWIYIGSQGILQGTYETFAELARQHFGGSLKGTLTLTAGLGGMGGAQPL
SVTMNEGVVIAVEVDEKRIDKRIETKYCDRKTASIEEALAWAEEAKLAGKPLSIALLGNA
AEVHHTLLNRGVKIDIVTDQTSAHDPLIGYVPEGYSLDEADRLRQDTPELYVRLAKQSMK
KHVEAMLAFQQKGSIVFDYGNNIRQVAKDEGLENAFDFPGFVPAYIRPLFCEGKGPFRWA
ALSGDPADIYRTDALLKELFPTNKALHRWIDMAQEKVTFQGLPSRICWLGYGERKKMGLA
INELVRTGELKAPVVIGRDHLDCGSVASPNRETEAMKDGSDAVGDWAVLNALVNTAAGAS
WVSFHHGGGVGMGYSLHAGMVAVADGSELADERLARVLTSDPGMGIIRHADAGYERAVEV
AKEQDIIVPMQK
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgactgatgtaaaaaaatcaatccgtgccaacagaggaacagagcttgaatgcttagga
tgggagcaagaggcagtgcttcggatgcttcgaaacaaccttgatccagaagtcgccgag
aagccggaggacctcatcgtatatggcgggattggcaaagccgcacgggattgggacgct
tttcacgccattgagcattccttgaaaacattaaaaaatgatgaaacattgctcgtgcaa
tccggaaagcccgttggcatgttccgtacacacccgcaggcccctcgcgtgctcctagca
aattctgttcttgttccgaagtgggcagactgggagcatttccacgaacttgagaaaaaa
gggttaatgatgtacggacagatgacggctggcagctggatttacattggctcacaaggc
atattgcaaggaacctatgaaaccttcgctgagctggcgcgacagcacttcgggggcagc
ttaaaaggaacgttgacgctgacagcgggtctcggcggaatgggaggcgcccagccgctg
tcagtcacgatgaatgaaggcgtcgtgattgccgtcgaggttgacgagaaacgcatcgac
aagcggatcgaaacaaaatactgcgatcgaaaaacagcatcgattgaggaagccttagct
tgggctgaagaggcaaagctggcaggaaaacctttgtccattgcacttctcggaaacgca
gctgaggtgcatcacacacttttgaaccgaggcgtcaaaattgatattgtgacagatcag
acatctgcccatgaccctttaatcggttatgttcccgagggctattcccttgatgaagct
gaccgtttgcgtcaagacactccagagctttacgtgcgccttgcgaagcaaagcatgaaa
aaacatgtcgaagccatgctggcctttcagcaaaagggctctattgtatttgactacggc
aacaatatccggcaagtcgcaaaggatgaagggctggagaatgccttcgattttccgggg
tttgtccctgcctacatccgccccttattctgtgaaggaaaagggccgttccgctgggcg
gcgctttccggagatccggcagatatttaccgtacggatgcgttattaaaagagctgttc
ccgacaaataaagcccttcaccgctggattgatatggcacaggaaaaagtcaccttccaa
ggcttgccgtcccgtatctgctggcttggatatggagaacgaaaaaagatgggcctcgcc
attaacgagctggttagaaccggggagctaaaagcgcctgtcgttattgggagagatcat
ttggactgcgggtctgtcgcctctccaaaccgggaaacagaagcgatgaaggatggaagt
gacgctgtcggtgattgggctgtgctaaatgcgcttgtcaacacggcggcgggtgcaagc
tgggtttccttccaccatggcggcggcgtcggaatgggctattcccttcatgccggcatg
gttgcagtggccgatggaagtgagctggctgacgagcggctcgcgcgggtcttaacgagc
gacccaggaatgggcattatccgtcatgcggatgcgggttatgaacgtgccgttgaagta
gcgaaggaacaggacattatcgtgccgatgcaaaaataa

DBGET integrated database retrieval system