KEGG   Bacillus subtilis subsp. subtilis 168: BSU39510
Entry
BSU39510          CDS       T00010                                 

Symbol
yxeL
Name
(RefSeq) N-acetyltransferase YxeL
  KO
K24117  S-(2-succino)cysteine N-acetyltransferase [EC:2.3.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU39510 (yxeL)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BSU39510 (yxeL)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9
Other DBs
NCBI-GeneID: 937563
NCBI-ProteinID: NP_391830
Pasteur: BG11888
BSORF: BG11888
UniProt: P54951 A0A6M4JQU4
LinkDB
Position
complement(4060307..4060804)
AA seq 165 aa
MKPRYRLAVERDAEQLLELTLRAYEPIRKLGIRFAAAHADLDLVLKNIRENACYVMEEDG
RIIATITLRMPWGKQPGPYGVPHIWWFAVDPDTGKKGIGTKLLQWLEETILRDTLKVPFV
SLGTADKHPWLIEMYERKGYVRSGEQDLGKGHITVYMKKQLRHDL
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaagccacgataccgccttgcagttgaacgtgatgccgaacagcttctcgagctgaca
ttgcgggcttatgaaccgattcgaaagctcggcattcgttttgctgctgctcatgcggat
ttggatttggtgctgaaaaatattcgggaaaatgcttgctacgtcatggaagaagacggg
cggatcatcgcgaccatcaccttgagaatgccttggggaaaacagccgggaccgtatggc
gttccgcatatctggtggtttgctgtggaccccgacaccggtaaaaaaggaatcggaaca
aagctgcttcaatggctggaggaaacaatccttcgcgatacgttaaaggttccgtttgtc
tcactcggaacagcggataagcatccgtggctgattgagatgtacgaacgaaaaggatat
gtccgctcaggtgaacaagaccttggaaaagggcatatcacagtctatatgaaaaaacaa
ttgcgacatgatctataa

DBGET integrated database retrieval system