KEGG   Bacillus subtilis subsp. subtilis 168: BSU39880
Entry
BSU39880          CDS       T00010                                 

Symbol
yxbC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: JmjC_2 Cupin_8 AraC_binding
Other DBs
NCBI-GeneID: 937640
NCBI-ProteinID: NP_391867
Pasteur: BG11353
BSORF: BG11353
UniProt: P46327 A0A6M3ZI74
Structure
LinkDB
Position
complement(4095915..4096907)
AA seq 330 aa
MSAVTESVLESIISPVTMSEFLEEYWPVKPLVARGEVERFTSIPGFEKVRTLENVLAIYN
NPVMVVGDAVIEESEGITDRFLVSPAEALEWYEKGAALEFDFTDLFIPQVRRWIEKLKAE
LRLPAGTSSKAIVYAAKNGGGFKAHFDAYTNLIFQIQGEKTWKLAKNENVSNPMQHYDLS
EAPYYPDDLQSYWKGDPPKEDLPDAEIVNLTPGTMLYLPRGLWHSTKSDQATLALNITFG
QPAWLDLMLAALRKKLISDNRFRELAVNHQSLHESSKSELNGYLESLIQTLSENAETLTP
EQIFQSQDSDFDPYQSTQLVFRQLLTSYKF
NT seq 993 nt   +upstreamnt  +downstreamnt
atgagtgctgtaaccgaatcggttttggagtctatcatcagtcctgtaacgatgagtgag
tttttagaagaatattggcctgtaaaacctttggtagccagaggagaagtggagagattt
acaagcataccggggtttgaaaaggttagaacgctagaaaacgtattggctatctacaat
aatccagtcatggtcgttggtgatgctgtgattgaagaatctgaagggatcacagacaga
tttcttgtgtcacctgcagaggctttagagtggtatgaaaaaggggctgcattagagttt
gatttcaccgacctatttattccccaagtcagaaggtggatagaaaaactcaaagcggaa
ttaagactgcctgcgggtacttcttccaaagccattgtttacgcggcgaaaaatggcggg
ggattcaaagcccattttgacgcctacaccaacttgatttttcaaattcaaggtgagaaa
acatggaagcttgccaagaatgaaaatgtgagcaatccaatgcagcactatgatttatca
gaggctccttactatcctgatgatttacagtcatattggaaaggagatccgccaaaagag
gatctgccagatgcagaaatcgttaatttaacaccgggaaccatgctgtatttgccaaga
ggtttatggcactccaccaaatctgatcaagcaacgttagctttaaatattacatttggc
cagcctgcatggcttgacttgatgctagcagctcttcgaaaaaaattaatcagtgataac
agatttagagaactcgctgtaaatcatcaatccctacatgaatcgtccaaatcagagtta
aatggatatttggaaagtctgattcaaacgttatcagagaacgcagagacattgacccca
gagcaaatcttccaatctcaggattcagattttgatccttatcaatccacgcaattggta
ttcagacagcttttgacaagttataagttctag

DBGET integrated database retrieval system