KEGG   Bacillus subtilis subsp. subtilis 168: BSU40100Help
Entry
BSU40100          CDS       T00010                                 

Gene name
ahpF
Definition
(RefSeq) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU40100 (ahpF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BSU40100 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like AlaDh_PNT_C Thi4 DAO FAD_oxidored NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 937717
NCBI-ProteinID: NP_391890
Pasteur: BG11204
BSORF: BG11204
UniProt: P42974
LinkDB All DBs
Position
4119527..4121056
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKAEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDQSVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLEGTVERNRMGEIIVDKHGATSVPGLFAAGDC
TDSAYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaatatcaaagcacaattaaatcaatatatgcagctaattgagaat
gacattgttctcaaagttagcgcaggcgaagatgacacttctaaggacatgctggctctc
gttgatgagctggcttccatgtcatcgaaaatttcagttgaaaaagctgaattaaacaga
acgccgagcttcagtgtcaatcgtgtcggagaagacactggcgtgactttcgccggtatc
cctctgggccacgaattcacatcattagtgttggcgttgctccaagtgagcggcagaccg
cctaaggtagaccaaaaagtcattgatcaggtgaagaagatcagtggtgaataccacttc
gaatcttatatcagcctgacatgccacaactgtcctgatgttgtacaagctttaaacatg
atgagcgtgctgaacccgaacattacgcacacgatgattgacggtgcagcatacaaagca
gaagttgaaagcaaaaacatcatggcagtgccgaccgtttacctgaatggcgaatccttc
ggaagcggccgtatgacgcttgaagaaattcttgcgaaaatgggcagcggcacagatgca
tctgagtttgctgacaaagagccgtttgacgttcttgtggtcggaggcggacctgctggt
gcaagtgcagcgatctacactgcacgtaaaggcatccgaactggtgttgtcgctgagcgc
ttcggcggacaggttctcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgacg
gaaggaccgaagctagcggcaagtcttgaagagcatgtgaaggaatatgatattgatgtc
atgaaccttcagcgtgcgaaacgccttgagaagaaagatctgttcgaacttgaactcgaa
aacggcgctgtcctgaaaagtaaaacagtgatcctttcaacaggtgcacgctggcgcaat
gtcaacgtccccggtgaacaagagttcaaaaacaaaggtgtcgcatactgcccgcactgt
gatgggccattgtttgaaggcaaagacgttgcggtaatcggcggcggaaactctggtatc
gaagcagcgattgatcttgcaggtattgtcaatcacgttactgtactagaattcgcgccg
gaactgaaagcagacgaagtcctgcaaaaacgtctctacagcctgcctaacgttactgtc
gtgaaaaacgcacaaacaaaagaaatcacaggtgatcagagtgttaacggcatcacatat
gtagaccgcgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgccaaacacagaatggttagaaggaacggttgaacgcaaccgcatgggcgaa
attattgtcgacaaacacggcgcaacaagcgtaccaggcttatttgctgccggcgactgc
acagacagtgcgtacaaccaaattattatttctatgggatcaggtgcaactgccgccctc
ggcgcgtttgattacctaatccgtaactaa

DBGET integrated database retrieval system