KEGG   Bacillus subtilis subsp. subtilis 168: BSU40340
Entry
BSU40340          CDS       T00010                                 
Symbol
rocD
Name
(RefSeq) ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00330  Arginine and proline metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BSU40340 (rocD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU40340 (rocD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     BSU40340 (rocD)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class III
   BSU40340 (rocD)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2 Aminotran_5
Other DBs
NCBI-GeneID: 937755
NCBI-ProteinID: NP_391914
Pasteur: BG10722
BSORF: BG10722
UniProt: P38021 A0A6M3ZLX5
LinkDB
Position
complement(4144301..4145506)
AA seq 401 aa
MTALSKSKEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHR
HPKIIQALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAA
RRWAYEVKGVADNQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVE
ALRQAITPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGK
TFACDWDGIVPDMYILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSI
ASLEVLEDEKLADRSLELGEYFKSELESIDSPVIKEVRGRGLFIGVELTEAARPYCERLK
EEGLLCKETHDTVIRFAPPLIISKEDLDWAIEKIKHVLRNA
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgacagctttatctaaatccaaagaaattattgatcagacgtctcattacggagccaac
aattatcacccgctcccgattgttatttctgaagcgctgggtgcttgggtaaaggacccg
gaaggcaatgaatatatggatatgctgagtgcttactctgcggtaaaccaggggcacaga
cacccgaaaatcattcaggcattaaaggatcaggctgataaaatcaccctcacgtcacgc
gcgtttcataacgatcagcttgggccgttttacgaaaaaacagctaaactgacaggcaaa
gagatgattctgccgatgaatacaggagccgaagcggttgaatccgcggtgaaagcggcg
agacgctgggcgtatgaagtgaagggcgtagctgacaatcaagcggaaattatcgcatgt
gtcgggaacttccacggccgcacgatgctggcggtatctctttcttctgaagaggaatat
aaacgaggattcggcccgatgcttccaggaatcaaactcattccttacggcgatgtggaa
gcgcttcgacaggccattacgccgaatacagcggcattcttgtttgaaccgattcaaggc
gaagcgggcattgtgattccgcctgaaggatttttacaggaagcggcggcgatttgtaag
gaagagaatgtcttgtttattgcggatgaaattcagacgggtctcggacgtacaggcaag
acgtttgcctgtgactgggacggcattgttccggatatgtatatcttgggcaaagcgctt
ggcggcggtgtgttcccgatctcttgcattgcggcggaccgcgagatcctaggcgtgttt
aaccctggctcacacggctcaacatttggtggaaacccgcttgcatgtgcagtgtctatc
gcttcattagaagtgctggaggatgaaaagctggcggatcgttctcttgaacttggtgaa
tactttaaaagcgagcttgagagtattgacagccctgtcattaaagaagtccgcggcaga
gggctgtttatcggtgtggaattgactgaagcggcacgtccgtattgtgagcgtttgaag
gaagagggacttttatgcaaggaaacgcatgatacagtcattcgttttgcaccgccatta
atcatttccaaagaggacttggattgggcgatagagaaaattaagcacgtgctgcgaaac
gcataa

DBGET integrated database retrieval system