KEGG   Bacillus subtilis subsp. subtilis 168: BSU40620
Entry
BSU40620          CDS       T00010                                 
Symbol
yybJ
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40620 (yybJ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU40620 (yybJ)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_22 AAA_23 AAA_24 Mg_chelatase PIF1 AAA NACHT Zeta_toxin
Other DBs
NCBI-GeneID: 937807
NCBI-ProteinID: NP_391942
Pasteur: BG10021
BSORF: BG10021
UniProt: P37494 A0A6M4JR70
LinkDB
Position
4175869..4176525
AA seq 218 aa
MIEVLNLTKKIKKTTVLDNISYTFEKGTIYGLFGSNGSGKTMLLRALSGLIVPTEGSITI
KGEQLHKDISFPKSVGLIIENMQLLPQYDAFTNLKILSKIKKIASDNDILDSISRVGLEN
FNSVKVSKFSLGMKQRLNIAQAIFEKPDILLLDEPTNAIDEKGVAFVHDILLQEKKRGAT
IIITSHHKEDIISLCDIALEMNHGRLETSEKVIYKKDS
NT seq 657 nt   +upstreamnt  +downstreamnt
atgattgaggtattaaacctaacaaaaaaaattaaaaagactacagttttagataatatc
tcttatacatttgaaaaaggaacaatttatggactatttgggagtaatggttctggaaag
accatgctacttcgtgcattatccgggttaatagtccctactgaagggagtataactatt
aaaggtgaacaattacataaagatatctcttttcctaaaagtgtaggattaattatagaa
aatatgcagttacttcctcagtatgatgcttttactaaccttaaaattttgtcaaaaatt
aaaaagatcgcatcagataatgatatattagattctattagtagagttggtttggaaaat
tttaatagtgtaaaggttagtaaattctcgttaggaatgaaacaacgattaaatattgca
caggctatttttgaaaaacctgatatattgctacttgatgaaccaacaaatgcgattgat
gaaaaaggagttgcatttgttcatgacattcttttacaagagaaaaaaaggggagctacc
attattattactagtcatcacaaggaagatattatatctttatgtgacattgcattagaa
atgaatcatggacgtctagaaacttcagaaaaagtaatatataagaaagatagttag

DBGET integrated database retrieval system