KEGG   Bacillus subtilis subsp. subtilis JH642: BSUA_04336Help
Entry
BSUA_04336        CDS       T03443                                 

Gene name
yyaL
Definition
(GenBank) hypothetical protein
  KO
K06888  uncharacterized protein
Organism
bsul  Bacillus subtilis subsp. subtilis JH642
Brite
KEGG Orthology (KO) [BR:bsul00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSUA_04336 (yyaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredox_DsbH Thioredoxin_7 Glyco_hydro_76 Glyco_hydro_88 GlcNAc_2-epim LANC_like Thioredoxin_2 Pectate_lyase_2 Toprim
Motif
Other DBs
NCBI-ProteinID: AIC42577
LinkDB All DBs
Position
4163961..4166030
Genome map
AA seq 689 aa AA seqDB search
MPNKSKPNRLINEKSPYLLQHAHNPVDWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHV
MAHESFEDEEIARLLNERFVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQK
PFYAGTYFPKTSKFNRPGFVDVLEHLSETFANDREHVEDIAENAAKHLQTKTAAKTGEGL
SESAIHRTFQQLASGFDTIYGGFGQAPKFPMPHMLMYLLRYDHNTGQENALYNVTKTLDS
MANGGIYDHIGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYTEAYQVTQNSRYKEICEQ
IITFIQREMTHEDGSFFSALDADTEGEEGKYYVWSKEEILKTLGDDLGTLYCQVYDITEE
GNFEGKNIPNLIHTKREQIKEDAGLTEKELSLKLEDARQQLLKTREERTYPHVDDKVLTS
WNALMIAGLAKAAKVYQEPKYLSLAKDAITFIENKLIIDGRVMVRYRDGEVKNKGFIDDY
AFLLWAYLDLYEASFDLSYLQKAKKLTDDMISLFWDEEHGGFYFTGHDAEALIVREKEVY
DGAVPSGNSVAAVQLLRLGQVTGDLSLIEKAETMFSVFKPDIEAYPSGHAFFMQSVLRHL
MPKKEIVIFGSADDPARKQIIAELQKAFKPNDSILVAEQPEQCKDIAPFAADYRIIDGKT
TVYICENFACQQPTTNIEEAIHTLISSRD
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacaaaagtaaacccaatagattaatcaatgagaaatcaccatatttactccaa
cacgcccacaaccctgtggactggttcccgtggggagaagaagcttttgaaaaagcaaaa
cgcgaaaacaagccggttctggtcagcatcggttattcgacttgtcattggtgccacgtg
atggcccacgaaagctttgaagacgaagaaatcgcgcgtcttctcaatgaacggtttgtg
gcgattaaagtcgaccgggaagagcggcctgatgtggattctgtttatatgagaatctgc
cagctgatgaccgggcagggcggctggccgctgaatgtgtttatcacgcctgatcaaaag
ccgttttacgcgggtacatattttccaaagacgagcaaattcaatcgtcccggttttgtt
gatgtgcttgagcatctgtctgagacgtttgcgaacgaccgcgagcatgtcgaggatatt
gcggagaacgccgctaaacatttgcagaccaaaacagctgcaaaaactggtgagggcctt
agcgaatcagcgattcaccggacattccagcagcttgccagcgggtttgacacgatctac
ggcggtttcgggcaggcaccgaaatttccaatgcctcatatgctgatgtatttgctacgt
tatgatcacaatacagggcaggagaacgctctatacaacgtgacgaaaacattggacagc
atggcgaatggcggcatttacgatcatatcggctatgggttcgcccgctattcgaccgat
gacgagtggctcgttccccactttgaaaaaatgctgtacgacaatgcgctgctgctgacc
gcttatacagaagcctatcaggtcacgcaaaacagccgctataaagagatttgtgagcag
atcattacgttcattcagagggaaatgactcatgaagacggaagctttttctcggctttg
gacgcggacacagaaggagaagaaggaaagtactacgtgtggtcaaaggaagagattcta
aaaacgctcggggacgatctcggaacgctgtattgccaagtgtatgacatcactgaagaa
ggaaactttgaaggcaaaaatattcctaacctcattcacacaaagcgagaacaaatcaaa
gaggatgccgggttaaccgaaaaagagctcagtctcaaactcgaagacgcaagacagcag
ctcttgaagacacgcgaggaaagaacctatccgcatgtcgatgataaagtgcttacctca
tggaacgcgctgatgatcgcgggtcttgcgaaagcggcaaaggtataccaggagccgaaa
tatctcagcctagcgaaagacgccatcacatttattgaaaacaaattaatcatcgacggc
cgtgtgatggtccgatatcgtgatggcgaagtgaaaaacaaaggctttatcgacgattac
gcttttctcctatgggcttatctggatctctatgaagcttcgtttgatctttcttattta
caaaaagcgaagaaactgacagacgatatgatcagcttattttgggatgaggagcatggc
ggattctacttcaccggacacgatgcagaagccttaatcgtacgggaaaaagaagtgtac
gacggcgccgtgccttcaggaaacagtgtggcagctgttcagctgctgcgtctcgggcaa
gtcacaggcgacttatcactgatcgaaaaagcggaaacaatgttttccgtgttcaagcca
gacatagaagcgtatccgagcggccatgctttctttatgcaaagtgtgttaaggcatctg
atgcctaaaaaagaaatcgtgatttttggcagcgcagacgatccagccagaaaacaaatt
atagcggagcttcaaaaagcctttaagcccaacgactccattctggtggcagagcagccc
gagcaatgcaaagacattgcgccatttgcagcagactaccgcatcatagacggcaaaaca
accgtttatatttgtgaaaacttcgcctgccagcaaccgacaacaaatattgaagaagcg
atccacacattaataagcagcagggattaa

DBGET integrated database retrieval system