KEGG   Bacillus subtilis XF-1: C663_2540
Entry
C663_2540         CDS       T02459                                 

Gene name
levE
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIB component
  KO
K11195  fructose PTS system EIIB component [EC:2.7.1.202]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00051  Fructose and mannose metabolism
bsx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C663_2540 (levE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    C663_2540 (levE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsx02000]
    C663_2540 (levE)
Enzymes [BR:bsx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     C663_2540 (levE)
Transporters [BR:bsx02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    C663_2540 (levE)
SSDB
Motif
Pfam: PTSIIB_sorb Msg2_C
Other DBs
NCBI-ProteinID: AGE64297
UniProt: M4KTP6
LinkDB
Structure
PDB: 
1BLE

Position
complement(2573309..2573800)
AA seq 163 aa
MMNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASA
VSVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKS
VSVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgatgaacattgtgttagcaagaattgatgaccgctttattcacggccaaatcctgaca
aggtggataaaagtccatgcagccgaccgaatcatcgttgtctccgacgatattgctcag
gacgaaatgagaaaaacgctgatcctttctgttgcgccttcaaatgtaaaggcgagtgcc
gtctcggtttctaaaatggcaaaagcatttcatagtccgcgctacgaaggggtaacggca
atgctcctgtttgaaaatccgtccgatattgtatctcttatagaagcaggtgtaccgatc
aaaaccgtaaacgtggggggaatgcgttttgaaaatcatcgcaggcaaatcacaaaatca
gtcagtgtcacagaacaagatataaaggcatttgaaacattaagtgacaagggcgtgaaa
ctggaattgaggcagctgccttcagatgccagtgaggattttgtacagattttacggaac
gtaacaaaataa

DBGET integrated database retrieval system