KEGG   Bos taurus (cow): 100124507Help
Entry
100124507         CDS       T01008                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bta  Bos taurus (cow)
Pathway
bta03030  DNA replication
bta03410  Base excision repair
bta03420  Nucleotide excision repair
bta03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100124507 (LIG1)
   03410 Base excision repair
    100124507 (LIG1)
   03420 Nucleotide excision repair
    100124507 (LIG1)
   03430 Mismatch repair
    100124507 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bta03032]
    100124507 (LIG1)
   03400 DNA repair and recombination proteins [BR:bta03400]
    100124507 (LIG1)
Enzymes [BR:bta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100124507 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100124507 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100124507 (LIG1)
DNA replication proteins [BR:bta03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100124507 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100124507 (LIG1)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100124507 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100124507 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100124507 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 PucR DDR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 100124507
NCBI-ProteinID: NP_001096018
BGD-bta: BT16412
Ensembl: ENSBTAG00000014595
VGNC: 30882
UniProt: A4IFC8
LinkDB All DBs
Position
18
AA seq 916 aa AA seqDB search
MQRSIMSFFQPKKEGKAKKPEKETAKSIRETESPPKVALKERNRVVSEGDSPVKRPGRKA
TRVLGSEGEEEEEEAPTTPRSQKPASDSPQASPPSPVTLPESSPSHSKPSPAVASPSGIP
KRRTARKQLPKRTFQDVLKEQGEDKDPETKKKKEEEAETPIESLPEPEGDDKEEVEGGDQ
PTTPPEPRKTSTESLTESVSEPGVTVKQEPQEDGQAQPPPKTPKTLSSFFSPRKPAVKKE
AKEEGPGALRKDEIKGHVDPASYNPAKNNYHPIEDACWKAGQRVPYLAVARAFEKIEEVS
ARLRMVETLSNLLRSVVALSPADLLPVLYLSLNRLGPPQQGLELGIGEGILLKAVAQATG
RQLESVRAEVAEKGDVGLVAESSRSTQRLVLPPPALTAAGVFAKFRDIAQLAGSASTTKK
IDVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPSQECPPAVVDA
GKGKTAEARKTWLEEQGMILKQTFCEVPDLERIVPVLLEHGLERLPEHCRLSPGVPLKPM
LAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGRYPDIIS
RIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLI
YLNGKSLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTEQIAEFLEQSVKDSCEGLM
VKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRAGRYGGFLLASY
DEESEEFQAICKLGTGFSDEELEEHHQRLQALVLPTPRSYVRADGAVAPDHWLDPSDVWE
VKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPEQATTSAQVAGLYKKQSQI
QNQQGAEPDSEQEEFY
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccagcccaagaaagagggcaaagcgaagaagcca
gagaaggagacagccaagagcatcagagaaacagagtcccctccgaaggtggcgctgaag
gagcggaatcgagtggtgtctgagggtgactctccagtgaagaggccagggaggaaggcg
acccgggtcctgggcagcgagggcgaggaggaggaagaggaagcccccaccacccccaga
agccagaagcctgcttcagactctccacaggcctcgcctcccagtcctgtcacactgcct
gagagcagcccttcccactccaaaccctccccagcagttgcatccccatcagggatcccg
aagcgtcgcacggcccggaagcagcttcccaaacggacatttcaagatgttctgaaagag
cagggcgaggacaaggatccagaaactaagaagaagaaggaggaagaagcggagacacca
atagaaagcctcccagagcctgaaggggacgacaaggaggaagtggaaggtggggaccag
cccacgacgccccctgagccccggaagacctccacagagtccctgacagaaagcgtctca
gagcccggggtgacggtgaagcaggaaccacaggaggatggccaggctcaaccgcccccc
aaaactccaaagaccctcagcagtttcttctccccccggaagccagctgtcaaaaaagaa
gcgaaagaagaaggacctggtgctctgagaaaggacgagatcaagggacacgtggaccca
gcgagctataatcctgccaagaacaactatcaccccatcgaagatgcctgctggaaggcg
ggccagagggttccttatctggctgtggcccgggcgttcgagaagatcgaggaggtctct
gctcggctccggatggtggagacgctgagcaacctgctgcgctccgtggtggccctgtca
cctgctgacctcctgcccgtcctctacctgagcctcaaccgcctggggccgccccagcag
ggcctggagctcggcatcggagagggcatcctcctcaaggcagtggcccaggccacgggt
cggcagctggagtccgtccgggccgaggtggccgagaagggtgatgtggggctggtggcc
gagagcagccgcagcacccagaggctcgtgctgcccccgcctgcgctcactgccgccggc
gtcttcgccaagttccgggacatcgcgcagctggcaggcagcgcttccacaaccaagaag
attgacgtcatcaaaggcctctttgtggcctgccgtcactcagaggcacgtttcattgcc
agagccctgagtggacggctgcgcctcgggttggctgagcagtcggtgctggcggccctc
gcccaggccgtgagcctcacgccccccagtcaagaatgcccccccgccgtggtggacgcc
gggaagggcaagacggcagaagccagaaagacgtggctggaggagcaaggcatgatcctg
aagcagactttctgtgaggtacctgacctggagcggatcgtccccgtgcttctggaacac
ggcctggagcggctcccggagcactgcagactgagcccaggggttcccctgaaaccaatg
ttggcccaccccacccggggtgtcagtgaggtcctgaagcgctttgaggaggcagctttc
acctgcgagtacaaatacgacgggcagagggcacagatccacgttctggaaggcggggag
gtaaagatcttcagcaggaatcaggaggacaatactggaaggtaccccgacattatcagc
cgcatccctaagattaaactcccatcggtcacatccttcatcctagacacagaagctgta
gcttgggaccgggaaaagaagcagatccagccattccaagtcctcaccacccgcaaacgc
aaggaggtggacgcggcggagatccaggtgcaggtgtgtctgtatgccttcgatctcatt
tacctcaacggaaagtccctggtacgtgagcccctctcccgacgccggcagctgctccgg
gagaacttcgtggagacggagggcgagttcgtctttgccacctccctagacaccaaggac
acggagcagatcgcagagttcttggagcagtcggtgaaagactcctgcgaggggctgatg
gtgaagaccctggacgtggacgccacctacgagatcgccaagaggtcacacaactggctc
aagctgaagaaggactacctcgagggtgtgggcgacaccctggacctcgtagtgattggt
gcctacctgggcaaggggaaacgggccggccggtacgggggcttcctgctggcctcctat
gacgaggagagcgaggagttccaggccatctgcaagctcggaactggcttcagtgacgag
gagctggaagagcaccaccagaggctccaggccttagtgctgcccaccccgcgctcctac
gttcgggctgacggtgcggtggcccccgaccactggctggaccccagcgacgtgtgggag
gtgaagtgcgcggacctctccctgtcccccatctaccctgcggcccgaggcctggtggac
agcgagaaggggatctccctccgcttccctcggtttattcgcgtccgtgaggataagaag
ccggagcaggccactaccagtgcccaggtggccggtctgtacaagaagcagagtcagatt
cagaaccagcagggtgcggagccggactccgagcaggaagagttctactag

DBGET integrated database retrieval system