KEGG   Bos taurus (cow): 101903592Help
Entry
101903592         CDS       T01008                                 

Gene name
IQCA1L
Definition
(RefSeq) IQ and AAA domain-containing protein 1-like
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ AAA_16
Motif
Other DBs
NCBI-GeneID: 101903592
NCBI-ProteinID: XP_015326274
BGD-bta: BT26991
Ensembl: ENSBTAG00000018838
VGNC: 30249
LinkDB All DBs
Position
4
AA seq 819 aa AA seqDB search
MSEAAYQRLWDSSHLILEELLDQEPLLGEAVSESERQPFQYRLSSLYLHYLGLLRRFDTL
YDQMVQPQKRRLLRRLLDSVACRVLELKDDLVRADLCETHCLDQVLQDLKLTPADLEVPI
PRYFELERSSILKEREHMLVELLSRLKPEISEWSFPILSRTEAIILLQKAERARQGRLRA
TFMREIRKEEERDRKIREEGRFKFSQDEAAVTIQKVWKGYLQRKRTQQDRRTEMEFIGML
PSASPVEPMGARSQASLGADVRRLRQTEKEEEFQLAVVKAHDHLREVEGPDMKEKMKEQI
RQWFIECHALTGRFPDYPDESLGGSSLIFADKTPEQVRMELEVQVQENKKKEQEKSKGKE
KEEEEKQKKKGEKTKKGEADTMLRALPSKSVPAINAGHKEYTNLWKNRFDSLFPSQSFDS
ETLKIEERKDVEQEIRIQVDDLMRQELKNLRLAVDREETRPVKPPKKKAGKKPGKKKKEK
DLTPDRPMDSLFEELVVLGLLKKSETVPLKDYIGDCLYLGSALNLANKLPMPSLADIRQN
MALYGILRLGSPDIHSMAPLIRSILLVGPSGMGKKMLVKAVCTETGANLFDLSPENLQGK
YPGKTGVQMLVHVVFKVARYLQPSVIWIGNAEKTFYKRVPKEEEEMDPKRIKKDLTKALR
LLSPGDRVMLIGTTDRPQVAEMKGLCRTYERILLLPRPDYASRYVLWRHMIEAQGAQGTQ
HLDISALAKVSDGYTAGCILQAIQAVLTERRLLQLSKRPLLTSEFLGPLAKLDPVYREEE
ESLKDWYFKTPLGKKRMKLLKDQDAAEEAKLAKEKKKKK
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggcagcttaccagcgcctctgggactcctcccacctgatcttggaagagctt
ctggaccaggagccactgctgggggaagccgtttccgagagcgaacggcagcccttccag
taccggctctcctcgctctatctgcactacctggggctgctgcgccgcttcgacaccctt
tacgaccagatggtgcagccgcagaagcggcggctgctgcggcgcctgctggacagcgtg
gcctgccgcgtgctggagctcaaagacgatctggttcgcgccgacctgtgtgagacccac
tgcctggaccaagtcctgcaggacttaaagctcaccccggcagacctggaggttccgatt
cccaggtatttcgagctggagcggtccagcatcctgaaggagcgagaacacatgctggtg
gagctgctgtccagactgaagccagagatctcagagtggagctttccaatattaagccgg
actgaggccataatcctactgcaaaaggccgagcgggccaggcaaggcaggctccgggcc
accttcatgcgggagattcggaaagaggaggagcgagaccggaagattcgggaggaaggt
cggttcaagttcagtcaggacgaagcagccgtcaccatacagaaggtatggaagggttac
ctgcagaggaaacgaactcagcaggaccggcgaaccgagatggagttcattggcatgctc
ccctcagccagcccggtggagcccatgggcgcccggtcccaggccagcctcggggcagat
gtgcgcaggctccggcagaccgagaaggaggaggagttccagctggctgtggtgaaggcc
cacgaccacctcagggaggtggaggggcccgacatgaaggagaagatgaaggagcagatc
cgacagtggttcattgagtgccatgccctcaccggccgattccctgattatccagacgag
tctttaggtggatcctccctgatctttgcagacaagactccagaacaggtgaggatggaa
ctggaggtgcaagtccaggagaacaaaaaaaaagagcaagagaaaagtaaggggaaagaa
aaggaggaagaagagaaacagaagaagaagggagaaaagaccaagaagggagaagcggac
acgatgcttagagcactgccttccaaatccgtccctgcgattaacgccggccacaaggag
tacacgaatctgtggaagaaccggtttgacagcctctttcccagccagagttttgactct
gagaccctcaagatagaagagaggaaagacgtggaacaggaaatccggatacaggtggat
gatctgatgcgtcaggagctgaagaacctgaggctggccgtggacagggaggagacgaga
cccgtgaagcctccaaagaaaaaggcgggcaagaaacctgggaagaagaagaaggaaaaa
gacctgaccccagacaggcctatggactccctgtttgaagagctcgtcgtcttaggcctt
ctaaagaagagtgagacagtgcccttgaaagactacattggtgactgcctctatctcgga
tcggctctgaacttggcaaacaagctgcctatgccctccctggctgacatccggcagaac
atggccttgtatgggattctgcggctaggctccccagatatacactccatggctcccctc
atccgctccatcctcctggtgggtccctccggtatgggcaagaagatgctggtgaaggcc
gtatgcacggagactggtgccaaccttttcgacctgtcgccggagaacctgcagggcaaa
taccccggcaagactggggtgcagatgctggtgcacgttgtctttaaggtggctcgatac
ctacagccttctgtgatctggattgggaatgcggagaagactttctacaaacgagtcccc
aaagaagaggaggagatggacccaaagcgaataaagaaggacctcaccaaggccctgcgg
ctgctgagtcccggggaccgcgtgatgctgatcgggaccaccgaccggccgcaggtggcc
gagatgaagggcctttgccgcacctacgagcgcatcctcctcctgcctcggcccgattat
gcctctcgctatgtgctctggaggcatatgatcgaggcccagggagcccaggggacccag
cacctggacatcagtgccctggccaaggtgtctgacggctacacagctggctgcatcctc
caagccatccaggcagtgctgaccgagcggcggctcctgcagttgtccaagaggcccctc
ctgacctcagagttcctggggcctctggcaaagctggacccggtgtacagggaggaggag
gagtccctgaaggactggtacttcaagaccccactgggcaagaagaggatgaagcttctc
aaggaccaggacgctgctgaggaagccaagctggcaaaggagaagaagaagaagaagtga

DBGET integrated database retrieval system