Bos taurus (cow): 280822 Help Entry 280822            CDS       T01008                                  Gene name IL2 Definition (RefSeq) interleukin-2 precursor   KO K05429   interleukin 2 Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04061   Viral protein interaction with cytokine and cytokine receptor bta04151   PI3K-Akt signaling pathway bta04625   C-type lectin receptor signaling pathway bta04630   JAK-STAT signaling pathway bta04658   Th1 and Th2 cell differentiation bta04659   Th17 cell differentiation bta04660   T cell receptor signaling pathway bta04672   Intestinal immune network for IgA production bta04940   Type I diabetes mellitus bta05135   Yersinia infection bta05142   Chagas disease bta05162   Measles bta05166   Human T-cell leukemia virus 1 infection bta05200   Pathways in cancer bta05320   Autoimmune thyroid disease bta05321   Inflammatory bowel disease bta05330   Allograft rejection bta05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     280822 (IL2)    04151 PI3K-Akt signaling pathway     280822 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     280822 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     280822 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     280822 (IL2)    04660 T cell receptor signaling pathway     280822 (IL2)    04658 Th1 and Th2 cell differentiation     280822 (IL2)    04659 Th17 cell differentiation     280822 (IL2)    04672 Intestinal immune network for IgA production     280822 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     280822 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     280822 (IL2)    05321 Inflammatory bowel disease     280822 (IL2)    05330 Allograft rejection     280822 (IL2)    05332 Graft-versus-host disease     280822 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     280822 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     280822 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     280822 (IL2)    05162 Measles     280822 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     280822 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bta04052]     280822 (IL2)    00536 Glycosaminoglycan binding proteins [BR:bta00536]     280822 (IL2) Cytokines and growth factors [BR:bta04052]  Cytokines   Interleukins    280822 (IL2) Glycosaminoglycan binding proteins [BR:bta00536]  Heparan sulfate / Haparin   Cytokines    280822 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 DUF922 Motif Other DBs NCBI-GeneID:  280822 NCBI-ProteinID:  NP_851340 BGD-bta:  BT12236 Ensembl:  ENSBTAG00000020883 VGNC:  30137 UniProt:  P05016 B2BB68 LinkDB All DBs Position 17 AA seq 155 aa AA seqDB search MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH TFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG SETRFTCEYDDATVNAVEFLNKWITFCQSIYSTMT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat acatttgacttttacgtgcccaaggttaacgctacagaattgaaacatcttaagtgttta ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac cccagagagatcaaggattcaatggacaatatcaagagaatcgttttggaactacaggga tctgaaacaagattcacatgtgaatatgatgatgcaacagtaaacgctgtagaatttctg aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system