KEGG   Bos taurus (cow): 282648
Entry
282648            CDS       T01008                                 

Gene name
CACNA1A
Definition
(RefSeq) voltage-dependent P/Q-type calcium channel subunit alpha-1A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04721  Synaptic vesicle cycle
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04728  Dopaminergic synapse
bta04730  Long-term depression
bta04742  Taste transduction
bta04930  Type II diabetes mellitus
bta05017  Spinocerebellar ataxia
bta05032  Morphine addiction
bta05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    282648 (CACNA1A)
   04020 Calcium signaling pathway
    282648 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    282648 (CACNA1A)
   04727 GABAergic synapse
    282648 (CACNA1A)
   04725 Cholinergic synapse
    282648 (CACNA1A)
   04728 Dopaminergic synapse
    282648 (CACNA1A)
   04726 Serotonergic synapse
    282648 (CACNA1A)
   04730 Long-term depression
    282648 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    282648 (CACNA1A)
   04721 Synaptic vesicle cycle
    282648 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    282648 (CACNA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    282648 (CACNA1A)
  09165 Substance dependence
   05032 Morphine addiction
    282648 (CACNA1A)
   05033 Nicotine addiction
    282648 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    282648 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    282648 (CACNA1A)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   282648 (CACNA1A)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Other DBs
NCBI-GeneID: 282648
NCBI-ProteinID: NP_001068597
Ensembl: ENSBTAG00000014828
VGNC: 26672
UniProt: Q1ADE8
LinkDB
Position
7
AA seq 2499 aa
MARFGDEMPARYGGGGSGAAAGVVVGAGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQH
LPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTG
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDVG
ALRRATIKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFY
IRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMY
GLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWAS
LRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIM
TVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLAN
AQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRT
SEMRKQNLLASREALYNEMDPDERWKASYARHLRPDMKTHLDRPLVVDPQENRNNNTNKS
RAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSSSVGLDTRRPWAGSQEAELSREGPYG
RESDHHAREGGLEQPGFWEGEAERGKAGDPHRRHAHRQAGSRESRSGSPRTGADGEPRRH
RAHRRPGDEAPDDKADRRSRHREGSRPARGGEGESEGPDGGGERRRRHRHGPPPAYDADM
RREDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAE
SASPHDSLSHAGLPQSPAKMGNSMDPGPTPAPTTTATNPQNAVSRRTANNPGNPSNPGPP
KTPENSLIVTNPSSTQANSAKTARKPDHTTVDIPPACPPPLNHTIIQVNKNANPDPLPKK
EEEKKEEEEDDPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSS
IALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDF
IVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVF
NILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKK
YEFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVF
PFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYR
MWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVM
AFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTI
RILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNN
FRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTHECGNEFAYFYFVSFIFLC
SFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHYKDMYSLLRV
ISPPLGLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQ
MDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMR
EEQNRTPLMFQRMEPPSPTQEGGPGQNALPSTQLDPGGGLMAHESGMKESPSWVTQRAQE
MFQKTGTWSPERGPPTDMPNSQPNSQSVEMREMGRDGYSDSEHYFPVEGQARAASMPRLP
AENQRRRGRPRGNNLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRD
RGHRTSERSLGRYTDVDTGLGTDLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHH
HHPPPPDKERYTQERPEHGRPRARDQRWSRSPSEGREHMAHRQGSSSVSGSPAPSTSGTS
TPRRGRRQLPQTPSTPRPHVSYSPVIRKAGGSGPQQQQQQPAARPGRTAPSGPRRYPGPV
AEPLAGERPPTGGHGSSRSPAMERRIPGPARSESPRAPCRHGGARWPASGAHAAEGPPGP
RHHHGYYRGSDYDEADGPGGGGGEEEEPRAAAYDAPPPARHGCSPRTPRAAGPACASPSR
HGRRLPNGYYPAHGLARPRGPGSRKGLHEAYSESDDDWC
NT seq 7500 nt   +upstreamnt  +downstreamnt
atggcccgcttcggagacgagatgccggcccgctacgggggaggaggctccggggcagcc
gccggggtggtcgtgggcgccggaggcgggcgaggagccgggggcagccggcagggcggg
cagcccggggcgcaaaggatgtacaagcagtcaatggcgcagagagcgcggaccatggcc
ctctacaaccccatccccgtccgacagaactgcctcacggtcaaccggtctctattcctc
ttcagcgaggacaacgtggtgagaaaatacgccaaaaagatcaccgaatggcctcccttt
gaatatatgattttagccaccatcatagcaaactgcatcgtcctcgccctggagcaacac
ctacctgatgatgacaagactccgatgtctgaacgactggatgacacagaaccatacttc
attggaattttttgtttcgaggctggaattaaaatcatcgcccttggatttgccttccat
aaaggctcttacttgaggaacggctggaatgtgatggactttgtggtggtgctaacaggc
atcttggcaacagttgggacggagtttgacctaaggacgctgagggcagttcgagtgctg
cggccgctcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtcgatcatg
aaggcaatgatccccctgctgcagatcggcctcctcctattttttgcaatccttattttt
gcaatcatagggttagaattttatatgggaaaatttcataccacctgctttgaagagggc
acagatgacattcagggtgagtctccagcaccgtgtgggacagaggaacctgcccgcacc
tgccccaatgggaccaaatgtcagccctactgggaaggacccaacaatgggatcactcag
ttcgacaacatcctgtttgcagtgctgactgttttccagtgcatcaccatggaagggtgg
actgacctcctctacaacagcaacgatgcctcagggaacacttggaactggttgtacttc
atccccctcatcatcatcggctccttttttatgctgaacctcgtgctgggtgtgctttct
ggggagtttgccaaagaaagggagcgggtggagaaccggcgggcatttctgaagctgagg
cggcagcagcagattgaacgagagctcaatgggtacatggagtggatctcaaaagcagaa
gaggtgatcctcgccgaagatgaaactgatggggagcagagacatccctttgatgttgga
gctctgcggagagccactataaagaagagcaagacagacctgctcaaccccgaggaggct
gaggatcagctggccgacatcgcctctgtggggtctcccttcgcccgagccagcattaaa
agtgccaagctggagaactcaactttttttcacaaaaaggagaggaggatgcgtttctac
atccgccgcatggtcaaaactcaggccttctactggactgtgctcagtctggtagccctc
aacacgctgtgtgtcgctatcgttcactacaaccagcctgagtggctctccgacttcctc
tactatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatgtac
gggcttgggacgcggccttacttccactcttccttcaactgttttgattgtggggtcatc
atcgggagtatctttgaggtcatctgggctgtcataaaacccggcacatcctttggaatc
agtgtgttacgagccctcaggttattgcgtattttcaaagtcacaaagtactgggcatct
ctcaggaacctggtcgtctctcttctcaactccatgaaatccatcatcagcctgttgttc
ctccttttcctattcatcgtcgtctttgcccttctgggaatgcaactctttggcggccag
tttaatttcgatgaagggactcctcctaccaacttcgacacttttccagcagcaataatg
acagtttttcagatcctgacgggcgaagactggaacgaggtcatgtatgacggcatcaag
tctcaggggggcgtgcaaggcggcatggtgttctccatctacttcatcgtgctgacgctc
ttcgggaactacaccctcctgaacgtgttcttggccatcgcggtggataatctggctaac
gcccaggagctcaccaaggatgaacaagaagaagaagaggcagccaaccagaaacttgcc
ctacagaaagccaaggaggtggcagaagtgagtcctctgtctgcagccaacatgtccata
gctgtgaaggagcaacagaagaaccagaagcccgccaagtcggtgtgggagcagcggaca
agcgagatgaggaagcagaatcttctggccagtcgggaggcactctacaacgagatggac
ccagacgagcgctggaaggcctcctacgctcgccacctgcggcccgacatgaagacccac
ctggaccggccgctggtggtcgacccccaggagaaccgtaacaacaacaccaacaagagc
cgggcggccgagcccacggtggaccagcgcctcgggcagcagcgagccgaggacttcctc
aggaaacaggcccgctaccacgaccgggcccgggaccccagcagctccgtgggcctggac
acccggaggccctgggcgggcagccaggaagccgagctgagccgggaggggccttacggt
cgcgagtcggaccaccacgcccgggagggcggcctggagcagccggggttctgggagggc
gaggcggagcggggcaaggcgggcgacccgcaccggaggcacgcgcaccggcaggcgggc
agccgcgagagccgcagcgggtccccgcgcaccggggccgacggagagccccgccggcac
cgggcgcaccgcaggccgggcgacgaggccccggacgacaaggccgatcggaggtcccgg
caccgcgagggcagccggccggcccggggcggcgagggcgagagcgagggcccagacggc
ggcggcgagcggaggcggcggcaccggcatggccctcccccagcgtacgacgcggacatg
cgcagggaggacaaggagcgcaggcaccgcaggaggaaagagaaccagggctccggggtc
cccgtgtcaggccccaacctgtcgaccacacggccaatccagcaggacctgggccgccaa
gaccccccgctggccgaggatatcgacaacatgaagaacaacaaactggccactgcggag
tcagccagtccccacgacagcctcagccacgccggcctgccccagagcccagccaagatg
gggaacagcatggaccctggccccacaccggcccccaccaccacggccaccaaccctcag
aatgccgtcagtcgccggacagccaacaacccggggaacccgtccaaccccggccccccc
aagacccctgagaacagccttatcgtcaccaaccccagcagcacccaggccaactcagct
aagactgccaggaaacctgaccacaccacggtggacatccccccagcctgccccccccca
ctcaaccacaccatcatccaagtgaacaaaaacgccaacccagacccactgccaaaaaag
gaggaagagaagaaagaggaggaggaagacgaccccggggaagacggccccaagcccatg
cccccctacagctccatgtttatcctctctacgaccaacccccttcgccgcctgtgccat
tacatcctgaacctgcgctactttgagatgtgcattctcatggtcatcgccatgagcagc
atcgccctggcggccgaggatcctgttcagcccaacgcaccacgaaacaatgtgctgcga
tattttgactacgtttttacaggcgtctttacctttgagatggtgatcaagatgatcgac
ctggggctcgtcctgcaccagggtgcctacttccgtgacctctggaacattctcgacttc
atagtggtcagtggggccctggtggcctttgccttcactggcaatagcaaaggaaaggac
atcaacacgattaaatccctccgagtcctccgggtgctacgacctcttaaaaccatcaag
cggttgccaaagctcaaggccgtgtttgactgcgtggtgaactcgctcaagaacgtcttc
aacatcctcatcgtctacatgctgttcatgttcatcttcgccgtggtggccgtgcagctc
ttcaagggcaagtttttccactgcacggatgagtccaaggagtttgagaaagattgtcgc
ggcaagtacctcctctatgagaagaatgaggtaaaggcgagggatcgagagtggaagaag
tatgagttccattatgacaatgtgctgtgggcgctgctgaccctcttcaccgtgtccacg
ggagaaggctggccacaggtcctcaagcactcggtggacgccacctttgagaaccagggc
cccagccccgggtaccgcatggagatgtccatcttctacgtcgtctactttgtggtgttc
cccttcttctttgtcaacatctttgtggccttgatcatcatcaccttccaggagcagggg
gacaagatgatggaggagtacagcctggagaaaaatgagagggcgtgcatcgacttcgcc
atcagcgccaaacccctgacccggcacatgccgcagaacaagcagagtttccagtaccgc
atgtggcagttcgtggtgtccccgcctttcgagtacaccatcatggccatgatcgccctc
aacaccatcgtgctcatgatgaagttctacggggcctctgttgcttatgagaatgctctg
agagtattcaacatcgtcttcacctccctcttctcactggaatgtgtgctgaaagtcatg
gcttttgggattctgaattattttcgcgatgcctggaacatcttcgactttgtgactgtt
ctgggcagcatcaccgacatcctcgtgaccgagtttgggaataacttcatcaacttgagc
ttcctccgcctcttccgagctgcccggctcatcaaactcctccgtcagggttacaccatc
cgaattcttctctggacctttgtgcagtccttcaaggccctgccctatgtctgtctactg
attgccatgctttttttcatctacgccatcattgggatgcaggtgtttggcaacattggc
atcgatgtggaggacgaggacagtgatgaagatgaattccaaatcactgagcacaataac
ttccgcaccttcttccaggccctcatgcttctcttccggagtgccactggggaggcttgg
cacaacatcatgctttcctgcctcagcgggaaaccctgtgataagaactctggcatcctg
actcacgaatgcggcaatgaatttgcttatttttacttcgtttccttcatcttcctctgc
tcgtttctgatgctgaatctttttgttgccgtcatcatggacaactttgagtacctcacc
cgagattcctccatcctgggtccccaccacctggatgagtacgtgcgtgtctgggccgag
tatgaccctgcagcgtgcggtcggattcattataaggatatgtacagtttattgcgtgta
atatctccccctctcggcttaggcaagaaatgtcctcatagggttgcttgcaagaggctc
ctgcggatggatctgcccgtcgctgatgacaacaccgtccacttcaactctaccctcatg
gctctgatccgcacggccctggacatcaaaattgccaaaggtggagctgacaaacaacaa
atggatgctgagttgcggaaggagatgatggccatctggcccaatctgtcccagaagacg
ctggacctgctggtcaccccccacaagtccacggacctgacagtggggaagatctatgcg
gccatgatgatcatggagtattaccggcagagcaaggccaagaagcttcaggccatgcgc
gaggaacagaaccggacacctctcatgttccagcgcatggagcccccatcgccaacacag
gagggggggcctggccagaacgccctcccctccacccagctggacccaggaggaggcttg
atggctcacgaaagtggcatgaaagagagcccatcctgggtgacccagcgggcccaggag
atgttccagaagacgggcacatggagcccagagcggggcccccccactgatatgcctaat
agccaacccaactctcagtctgtggagatgcgagagatgggcagagacggctactctgac
agtgagcactacttccccgttgaaggccaggcccgggccgcctccatgccccgcctgcct
gccgagaaccagaggagaaggggccggccacgtgggaataacctcagtaccatctcagac
accagccccatgaagcgctcggcctccgtgctgggccccaaggcccggcgcctggacgac
tactccctggagagggtgccgcccgaggagaaccagcggcaccaccagaggcgcagagac
cgtggccaccgcacctccgagcgctccttgggccgctacacggacgtggacacaggcttg
gggacagacctgagcatgaccacccaatctggggacctgccatcaaaggaaagagaccag
gagcggggccggcccaaggaccggaagcatcggcaacaccaccaccaccaccaccaccac
caccatcccccgccccctgacaaggagcgctacacccaggagcggcctgagcacggccgg
ccccgggcccgtgaccagcgctggtcccgctcacccagtgagggccgggagcacatggcc
caccgtcagggcagtagttccgtaagtggaagcccagccccctcaacatctggtaccagc
actccgcggcggggacgccgccagctcccccagaccccctccactccccggccgcacgtg
tcctattcccccgtgatccgtaaggccggcggctcgggtccccagcagcagcagcagcag
cccgcggcgcggccgggccgaacggcccccagcggcccgcggaggtacccgggccccgtg
gccgagcccctggccggggagcggcctcccacgggaggccacggaagcagccgctcgccc
gcgatggagcggcggatcccgggcccggcccggagcgagtcccccagggcgccgtgtcgc
cacggcggggcgcgatggccggcgtccggcgcgcacgcggccgagggccccccgggcccc
cggcaccaccacggttactaccggggctccgactacgacgaggccgatggcccgggcggc
ggcggcggggaggaggaggagccccgggccgccgcctacgacgcgccgccccccgcgcgc
cacgggtgctcgcccaggactccccgggccgcgggcccggcctgcgcctcgccttccagg
cacggccggcgactcccgaacggctactacccggcccacggactggccaggccccgcggg
ccgggctcccggaaaggcctgcacgaagcctacagcgagagcgacgacgattggtgctaa

DBGET integrated database retrieval system