KEGG   Bos taurus (cow): 408013
Entry
408013            CDS       T01008                                 

Gene name
CACNA1D
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04218  Cellular senescence
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04530  Tight junction
bta04713  Circadian entrainment
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04727  GABAergic synapse
bta04728  Dopaminergic synapse
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04921  Oxytocin signaling pathway
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04927  Cortisol synthesis and secretion
bta04929  GnRH secretion
bta04930  Type II diabetes mellitus
bta04934  Cushing syndrome
bta04935  Growth hormone synthesis, secretion and action
bta04973  Carbohydrate digestion and absorption
bta05010  Alzheimer disease
bta05020  Prion disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05031  Amphetamine addiction
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    408013 (CACNA1D)
   04020 Calcium signaling pathway
    408013 (CACNA1D)
   04024 cAMP signaling pathway
    408013 (CACNA1D)
   04022 cGMP-PKG signaling pathway
    408013 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    408013 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    408013 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    408013 (CACNA1D)
   04929 GnRH secretion
    408013 (CACNA1D)
   04912 GnRH signaling pathway
    408013 (CACNA1D)
   04921 Oxytocin signaling pathway
    408013 (CACNA1D)
   04935 Growth hormone synthesis, secretion and action
    408013 (CACNA1D)
   04924 Renin secretion
    408013 (CACNA1D)
   04925 Aldosterone synthesis and secretion
    408013 (CACNA1D)
   04927 Cortisol synthesis and secretion
    408013 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    408013 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    408013 (CACNA1D)
   04270 Vascular smooth muscle contraction
    408013 (CACNA1D)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    408013 (CACNA1D)
  09156 Nervous system
   04724 Glutamatergic synapse
    408013 (CACNA1D)
   04727 GABAergic synapse
    408013 (CACNA1D)
   04725 Cholinergic synapse
    408013 (CACNA1D)
   04728 Dopaminergic synapse
    408013 (CACNA1D)
   04726 Serotonergic synapse
    408013 (CACNA1D)
   04723 Retrograde endocannabinoid signaling
    408013 (CACNA1D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    408013 (CACNA1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    408013 (CACNA1D)
   05020 Prion disease
    408013 (CACNA1D)
   05022 Pathways of neurodegeneration - multiple diseases
    408013 (CACNA1D)
  09165 Substance dependence
   05031 Amphetamine addiction
    408013 (CACNA1D)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    408013 (CACNA1D)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    408013 (CACNA1D)
   05414 Dilated cardiomyopathy
    408013 (CACNA1D)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    408013 (CACNA1D)
   04934 Cushing syndrome
    408013 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    408013 (CACNA1D)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   408013 (CACNA1D)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Other DBs
NCBI-GeneID: 408013
NCBI-ProteinID: NP_001179954
BGD-bta: BT10231
Ensembl: ENSBTAG00000010026
VGNC: 26674
UniProt: F1MTK5
LinkDB
Position
22
AA seq 2183 aa
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDMVAEEDPAPCAFSGNGRQCTANGTECRSGWAGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEESKRNTSMPTSETESVNTENVS
GEGENRGCCGSLWCWWRRRGAAKAGPSGCRRWGQAISKSKLSRRWRRWNRFSRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKVTIDDYREEDEDKDPYPP
CDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCH
KLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMMT
FGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFI
LYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGP
IYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDIL
NMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIVDVALSEADPTESESVPVP
TATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAML
FFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKQ
CDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPH
HLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNS
DGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDE
VTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNSTIALQAGLRTLHDIGPEIRRAISC
DLQDDDPEETKREDEEDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPP
ASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPSSTNANLNNANMCKAAPGKRPSIGNLELV
SENGHHSFHKHGREPHRRCSIKRTRYYETYIRSDSGDEQFPTICREDPEIHGYFRDPHCP
GEQEYFSSEEYYEDDSSPTGSRQSYGCGYYNWYLGSSLDFEWPRGYHHPQSFSEDDDSPV
GYDSRRSPRRRLLPPTPTSPRRSSFNFECLRRQSSQEEVPPSPAFPPRTALPLHLMQQQI
MAVAGLDSSKAQKYSPSHSTRSWATPPATPSYRDWTPCYTPLIQVERPEAPDQVNGSLPS
LHRSSWYTDEPSVSYRTFTPASLTVPSSFHNKNSDKQRSADSLVEAVLISEGLGRYARDP
KFVSATKHEIADACDLTIDEMESAASNLLNGNVHPRANGDVGPVSHRQDYELQDFGPGYS
DEEPDPGRDEEDLADEMICITTL
NT seq 6552 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcagcatcaacggcagcagcaagcggaccac
gcgaacgaggcaaactatgcaagaggcaccaggctccctctatctggtgaaggaccaact
tctcagccgaatagctccaagcaaaccgtcctgtcttggcaagctgcaatcgacgctgct
agacaggccaaggctgcccaaactatgagcacctccgcacccccacctgtcggatctctc
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtccaacagc
cgacctgcccgtgcccttttctgtttgtctctcaataaccccatccgaagagcctgcatt
agtatagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccattccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtcgaaacatttttgaagatt
atagcatatggattattgctacatcctaatgcttatgttaggaatggatggaatttactg
gattttgttatagtcatagtaggattgtttagtgtaattttggaacaattaaccaaagaa
acagaaggcggtaaccactccagtggcaaatcaggaggctttgacgtcaaagccctccgc
gcctttcgagtgttacgaccacttcgactagtatcaggagtgcccagtttacaagttgtc
ctgaactccattataaaagccatggttcccctccttcacatagcccttttggtattattt
gtaatcataatctatgctattataggattggagctttttattggaaaaatgcacaaaaca
tgtttttttgctgactcagatatggtggctgaagaggacccagcgccgtgtgcgttctca
gggaacggacgccagtgcaccgccaatggcacggagtgtaggagtggctgggctggcccc
aatggcggcatcaccaactttgacaactttgcctttgccatgctcaccgtgtttcagtgc
atcaccatggagggctggacagacgtgctctactgggtaaatgatgcgataggatgggaa
tggccatgggtgtattttgttagtctcatcatccttggctcatttttcgtccttaacctg
gttctcggtgtccttagtggagagttctcgaaggaaagggagaaagcaaaagcacgagga
gacttccagaagctccgggagaagcagcagctggaagaggatcttaagggctacttggac
tggatcacccaagcagaagacattgatcctgagaatgaagaagaaggaggcgaggagagc
aaacgaaataccagcatgcccaccagtgagacggagtctgtgaacacagagaacgtgagc
ggggaaggcgagaaccgaggctgctgtgggagtctctggtgctggtggagaagaagaggc
gctgccaaggccgggccctctgggtgtcggcgctggggtcaagccatctcaaagtccaag
ctcagccgccgctggcgccgctggaaccgcttcagtcgcagaaggtgtagggctgctgtg
aagtccgtcacgttttactggctggtcattgtcctggtgtttctcaacaccttaaccatt
tcctccgagcactacaaccagcctgactggttgacacagattcaagatattgctaacaaa
gtcctcttggctctgttcacctgtgagatgctggtcaaaatgtacagcttgggtctccag
gcgtactttgtctctcttttcaatcggtttgattgcttcgtggtgtgcggcggaattacc
gagacgatcctggtggaactggaaatcatgtctcccctgggcatctctgtgttccgctgt
gtgcggctcttgagaattttcaaagtgaccaggcactggacctccctgagcaacttggtg
gcatccttgttaaactccatgaagtccatcgcttcgctgctgcttctgctttttctcttc
atcatcatcttctccttgctggggatgcagctgtttggcggcaagtttaattttgatgaa
acgcaaaccaagcggagcaccttcgataatttcccgcaagcccttctcacagtgttccag
atcctgacaggcgaagattggaatgctgtgatgtatgacggtatcatggcgtatgggggc
ccatcatcttctggaatgatcgtctgcatctacttcatcatcctcttcatttgcggtaac
tatattctactgaatgtcttcttggccatcgctgtagacaatttagctgatgctgaaagt
ttgaatactgctcagaaggaggaagctgaagaaaaggaaaggaaaaagattgccagaaaa
gaaagtctggaaaataaaaagaacaacaaaccagaagtcaaccagatagccaacagtgac
aacaaggttaccatcgacgactacagagaagaggatgaggacaaggacccctacccaccc
tgtgatgtgccagtaggtgaagaggaagaggaggaggaagaggatgaacctgaggttcct
gctggcccccgtcctcgcagaatctctgagttgaacatgaaagagaaaatcgcccccatc
ccggaagggagtgctttcttcattctcagcaagaccaacccgatccgcgtgggctgccac
aagctcatcaaccaccacatcttcaccaacctcatccttgtcttcatcatgctgagcagc
gccgccctcgccgctgaggaccccatccgcagccactccttccggaacactatactgggt
tactttgactatgctttcacagccatctttactgttgaaatcctgttgaagatgatgacc
tttggcgctttcctccacaaaggcgctttctgcaggaactacttcaacttactggatatg
ctggttgttggggtgtctttggtgtcatttggcatccaatccagtgccatctctgttgtg
aagattctgagggtcctaagggtcctgaggcctctcagggccatcaacagagcgaaagga
cttaagcatgtggtccagtgtgtcttcgtggccatccggacgattggcaacatcatgatc
gtcaccacgctcctccagttcatgttcgcctgcatcggggtccagctcttcaagggaaag
ttctatcgctgcacagacgaagccaaaagtaaccccgaagagtgcagggggctcttcatc
ctctacaaggatggggatgttgatagtcctgtggtccgtgagaggatctggcaaaacagt
gatttcaactttgacaacgtcctctcggctatgatggctctgttcacagtctccacgttc
gagggctggcccgcgttgctgtacaaagccatcgattcgaacggagagaatgtgggcccc
atctacaactaccgtgtggagatctccatcttcttcatcatctacatcatcattgtcgca
ttcttcatgatgaacatcttcgtgggcttcgtcatcgtcacatttcaggagcagggagag
aaagagtataagaactgtgagctggacaaaaatcagcgtcagtgtgttgaatacgccttg
aaggcacgtccgctgcggagatacatccccaaaaacccctaccagtacaagttctggtac
gtggtgaactcctcgcctttcgaatacatgatgtttgtcctcatcatgctcaacacactc
tgcttggccatgcagcactacgagcagtccaagatgtttaatgacgccatggacatcctg
aacatggtcttcactggggtgttcactgtcgagatggttttgaaagtcattgcatttaag
cctaaggggtactttagtgacgcctggaacacctttgactccctcatcgtaatcggcagc
attgtagacgtggccctcagcgaagccgacccaactgaaagtgaaagtgtccctgtccca
accgctacacctgggaactctgaagagagcaatagaatctccatcacctttttccgtctt
ttccgagtgatgcgattggtgaagcttctcagcaggggggaaggcatccggacgctgctg
tggacttttattaagtccttccaggcgctcccgtatgtcgcccttcttatcgccatgctg
ttcttcatctacgcggtcatcggcatgcagatgttcgggaaagtggccatgagagataac
aaccagatcaacagaaacaacaatttccagacctttccccaggcggtgctgctgctcttc
aggtgtgcgacgggggaggcctggcaggaaatcatgttagcctgcctcccggggaagcaa
tgtgaccccgactcggattacaaccccggggaggaatacacatgtgggagcaacttcgcc
atcgtttatttcatcagtttttatatgctctgcgcatttctgatcatcaacctcttcgtg
gctgtcatcatggacaattttgattatctcacccgggactggtctattctggggcctcac
catttagatgaattcaaacggatctggtctgaatatgaccccgaggcaaagggcaggatc
aagcacctggacgtggtcactctgctccgccgcatccagcctcccctgggcttcgggaag
ttgtgtccacaccgggtagcctgcaagagactagttgctatgaacatgccactcaacagt
gatgggacagtcatgtttaatgcaactctgtttgctctggttcgaacggctcttaaaatc
aagactgaaggcaacctggaacaagctaatgaagaactccgagctgtgatcaagaaaatt
tggaagaaaaccagcatgaaactacttgaccaagttgttcctccagctggtgatgatgag
gtaaccgtggggaagttctatgccactttcctgatacaggactactttaggaaattcaag
aaacggaaagaacaaggactggtgggaaaataccccgcgaagaacagcacaattgcccta
caggcgggattaaggacactgcatgacattgggccagaaatccggcgtgctatatcatgc
gatttgcaagatgatgatccagaggaaacaaaacgagaagacgaagaagatgtgttcaaa
agaaatggtgccctgcttggaaaccatgtcaatcatgttaatagtgataggagagattcc
cttcagcagaccaataccacccaccgtcccctgcatgtccaaaggccttcaattccacct
gcaagtgatactgagaaaccgctgtttcctccagcaggaaattcggtgtgtcataaccat
cataaccataattccataggaaagcaagttcccagctcaacaaatgccaatctcaataat
gccaatatgtgcaaagctgcccctggaaagcggcccagcattgggaaccttgagcttgtg
tctgaaaacgggcatcattccttccacaagcatggccgtgagcctcacagaaggtgcagt
attaaaagaacccgctattatgaaacttacattaggtctgactcaggagacgagcagttc
ccgacgatttgccgggaggacccggagatacacggctacttcagggacccccactgccca
ggggagcaggagtatttcagcagcgaggagtactatgaggatgacagctcgcccaccggg
agcaggcaaagctacggctgcggctactataactggtacctgggcagcagcttggacttt
gagtggcctcgaggctaccatcacccccaaagcttctcagaggacgacgactcgcccgtt
ggctacgattcccggaggtctccgaggcgacgcctactacctcccacccctacatccccc
cgcaggtcttccttcaacttcgagtgcctgcgccggcagagcagccaggaggaggtcccg
ccgtcgcccgccttcccgccccgcacggccctgcctctgcacctgatgcagcagcagatc
atggcagtcgccggcctagattccagtaaagcccagaagtactcgccgagccactccacc
cggtcgtgggccacgcccccggccacgccgtcgtatcgggactggacgccgtgctatacc
ccgctgatccaggttgagcggccagaggccccagaccaggtcaacggcagcctcccgtcc
ctgcaccgcagctcgtggtacacggacgagcccagcgtctcctatcggacgttcacacca
gccagcctgaccgtccccagcagcttccacaacaagaacagcgacaagcagaggagcgcg
gacagcctggtggaggcagttctgatatccgaaggcttaggacggtacgcgagggaccca
aagttcgtgtcggcgacaaaacacgaaatcgccgatgcctgtgacttaaccatcgacgag
atggagagtgcggccagcaacctgctgaacgggaacgtgcatccgcgggccaatggagac
gtgggccccgtttcccaccggcaagactacgagctccaggactttgggcctggctacagc
gacgaggagccggaccccgggagggacgaggaggacctggcagacgagatgatttgcatc
accaccctgtag

DBGET integrated database retrieval system